qt5-doc-5.13.1-1-any.pkg.tar.xz


Advertisement

Description

qt5-doc - A cross-platform application and UI framework (Documentation)

Property Value
Distribution Arch Linux
Repository Arch Linux Extra x86_64
Package filename qt5-doc-5.13.1-1-any.pkg.tar.xz
Package name qt5-doc
Package version 5.13.1
Package release 1
Package architecture any
Package type xz
Homepage https://www.qt.io
License GPL3 LGPL3 FDL custom
Maintainer Antonio Rojas <arojas@archlinux.org>
Download size 155.83 MB
Installed size 425.70 MB

Alternatives

Package Version Architecture Repository
qt5-doc - - -

Requires

Name Value
qt5-base -

Download

Type URL
Mirror ftp5.gwdg.de
Binary Package qt5-doc-5.13.1-1-any.pkg.tar.xz
Source Package qt5-doc

Install Howto

  1. Enable the extra repository on /etc/pacman.conf:
    
    [extra]
    Include = /etc/pacman.d/mirrorlist
    
  2. Install qt5-doc xz package:
    # pacman -Sy qt5-doc

Files

Path
/usr/
/usr/share/
/usr/share/doc/
/usr/share/doc/qt/activeqt.qch
/usr/share/doc/qt/qdoc.qch
/usr/share/doc/qt/qmake.qch
/usr/share/doc/qt/qt3d.qch
/usr/share/doc/qt/qtandroidextras.qch
/usr/share/doc/qt/qtassistant.qch
/usr/share/doc/qt/qtbluetooth.qch
/usr/share/doc/qt/qtcharts.qch
/usr/share/doc/qt/qtconcurrent.qch
/usr/share/doc/qt/qtcore.qch
/usr/share/doc/qt/qtdatavis3d.qch
/usr/share/doc/qt/qtdbus.qch
/usr/share/doc/qt/qtdesigner.qch
/usr/share/doc/qt/qtdistancefieldgenerator.qch
/usr/share/doc/qt/qtdoc.qch
/usr/share/doc/qt/qtgamepad.qch
/usr/share/doc/qt/qtgraphicaleffects.qch
/usr/share/doc/qt/qtgui.qch
/usr/share/doc/qt/qthelp.qch
/usr/share/doc/qt/qtimageformats.qch
/usr/share/doc/qt/qtlabscalendar.qch
/usr/share/doc/qt/qtlabsplatform.qch
/usr/share/doc/qt/qtlinguist.qch
/usr/share/doc/qt/qtlocation.qch
/usr/share/doc/qt/qtlottieanimation.qch
/usr/share/doc/qt/qtmacextras.qch
/usr/share/doc/qt/qtmultimedia.qch
/usr/share/doc/qt/qtnetwork.qch
/usr/share/doc/qt/qtnetworkauth.qch
/usr/share/doc/qt/qtnfc.qch
/usr/share/doc/qt/qtopengl.qch
/usr/share/doc/qt/qtplatformheaders.qch
/usr/share/doc/qt/qtpositioning.qch
/usr/share/doc/qt/qtprintsupport.qch
/usr/share/doc/qt/qtpurchasing.qch
/usr/share/doc/qt/qtqml.qch
/usr/share/doc/qt/qtqmltest.qch
/usr/share/doc/qt/qtquick.qch
/usr/share/doc/qt/qtquickcontrols.qch
/usr/share/doc/qt/qtquickcontrols1.qch
/usr/share/doc/qt/qtquickdialogs.qch
/usr/share/doc/qt/qtquickextras.qch
/usr/share/doc/qt/qtremoteobjects.qch
/usr/share/doc/qt/qtscript.qch
/usr/share/doc/qt/qtscripttools.qch
/usr/share/doc/qt/qtscxml.qch
/usr/share/doc/qt/qtsensors.qch
/usr/share/doc/qt/qtserialbus.qch
/usr/share/doc/qt/qtserialport.qch
/usr/share/doc/qt/qtspeech.qch
/usr/share/doc/qt/qtsql.qch
/usr/share/doc/qt/qtsvg.qch
/usr/share/doc/qt/qttestlib.qch
/usr/share/doc/qt/qtuitools.qch
/usr/share/doc/qt/qtvirtualkeyboard.qch
/usr/share/doc/qt/qtwaylandcompositor.qch
/usr/share/doc/qt/qtwebchannel.qch
/usr/share/doc/qt/qtwebengine.qch
/usr/share/doc/qt/qtwebsockets.qch
/usr/share/doc/qt/qtwebview.qch
/usr/share/doc/qt/qtwidgets.qch
/usr/share/doc/qt/qtwinextras.qch
/usr/share/doc/qt/qtx11extras.qch
/usr/share/doc/qt/qtxml.qch
/usr/share/doc/qt/qtxmlpatterns.qch
/usr/share/doc/qt/activeqt/activeqt-activeqt-comapp-example.html
/usr/share/doc/qt/activeqt/activeqt-activeqt-hierarchy-example.html
/usr/share/doc/qt/activeqt/activeqt-activeqt-mediaplayer-example.html
/usr/share/doc/qt/activeqt/activeqt-activeqt-menus-example.html
/usr/share/doc/qt/activeqt/activeqt-activeqt-multiple-example.html
/usr/share/doc/qt/activeqt/activeqt-activeqt-opengl-example.html
/usr/share/doc/qt/activeqt/activeqt-activeqt-qutlook-example.html
/usr/share/doc/qt/activeqt/activeqt-activeqt-simple-example.html
/usr/share/doc/qt/activeqt/activeqt-activeqt-wrapper-example.html
/usr/share/doc/qt/activeqt/activeqt-container.html
/usr/share/doc/qt/activeqt/activeqt-dotnet.html
/usr/share/doc/qt/activeqt/activeqt-dumpcpp.html
/usr/share/doc/qt/activeqt/activeqt-dumpdoc.html
/usr/share/doc/qt/activeqt/activeqt-index.html
/usr/share/doc/qt/activeqt/activeqt-server.html
/usr/share/doc/qt/activeqt/activeqt-tools.html
/usr/share/doc/qt/activeqt/activeqt.index
/usr/share/doc/qt/activeqt/activeqt.qhp
/usr/share/doc/qt/activeqt/activeqt.qhp.sha1
/usr/share/doc/qt/activeqt/activeqt.tags
/usr/share/doc/qt/activeqt/examples-manifest.xml
/usr/share/doc/qt/activeqt/qaxaggregated-members.html
/usr/share/doc/qt/activeqt/qaxaggregated.html
/usr/share/doc/qt/activeqt/qaxbase-members.html
/usr/share/doc/qt/activeqt/qaxbase.html
/usr/share/doc/qt/activeqt/qaxbindable-members.html
/usr/share/doc/qt/activeqt/qaxbindable.html
/usr/share/doc/qt/activeqt/qaxcontainer-module.html
/usr/share/doc/qt/activeqt/qaxfactory-members.html
/usr/share/doc/qt/activeqt/qaxfactory.html
/usr/share/doc/qt/activeqt/qaxobject-members.html
/usr/share/doc/qt/activeqt/qaxobject.html
/usr/share/doc/qt/activeqt/qaxscript-members.html
/usr/share/doc/qt/activeqt/qaxscript.html
/usr/share/doc/qt/activeqt/qaxscriptengine-members.html
/usr/share/doc/qt/activeqt/qaxscriptengine.html
/usr/share/doc/qt/activeqt/qaxscriptmanager-members.html
/usr/share/doc/qt/activeqt/qaxscriptmanager.html
/usr/share/doc/qt/activeqt/qaxselect-members.html
/usr/share/doc/qt/activeqt/qaxselect.html
/usr/share/doc/qt/activeqt/qaxserver-demo-hierarchy.html
/usr/share/doc/qt/activeqt/qaxserver-demo-menus.html
/usr/share/doc/qt/activeqt/qaxserver-demo-multiple.html
/usr/share/doc/qt/activeqt/qaxserver-demo-opengl.html
/usr/share/doc/qt/activeqt/qaxserver-demo-simple.html
/usr/share/doc/qt/activeqt/qaxserver-demo-wrapper.html
/usr/share/doc/qt/activeqt/qaxserver-module.html
/usr/share/doc/qt/activeqt/qaxwidget-members.html
/usr/share/doc/qt/activeqt/qaxwidget.html
/usr/share/doc/qt/activeqt/images/activeqt-mediaplayer-example.jpg
/usr/share/doc/qt/activeqt/images/arrow_bc.png
/usr/share/doc/qt/activeqt/images/bgrContent.png
/usr/share/doc/qt/activeqt/images/btn_next.png
/usr/share/doc/qt/activeqt/images/btn_prev.png
/usr/share/doc/qt/activeqt/images/bullet_dn.png
/usr/share/doc/qt/activeqt/images/bullet_sq.png
/usr/share/doc/qt/activeqt/images/home.png
/usr/share/doc/qt/activeqt/images/ico_note.png
/usr/share/doc/qt/activeqt/images/ico_note_attention.png
/usr/share/doc/qt/activeqt/images/ico_out.png
/usr/share/doc/qt/activeqt/images/logo.png
/usr/share/doc/qt/activeqt/style/offline-simple.css
/usr/share/doc/qt/activeqt/style/offline.css
/usr/share/doc/qt/qdoc/01-qdoc-manual.html
/usr/share/doc/qt/qdoc/03-qdoc-commands-markup.html
/usr/share/doc/qt/qdoc/04-qdoc-commands-textmarkup.html
/usr/share/doc/qt/qdoc/05-qdoc-commands-documentstructure.html
/usr/share/doc/qt/qdoc/06-qdoc-commands-includecodeinline.html
/usr/share/doc/qt/qdoc/07-0-qdoc-commands-includingexternalcode.html
/usr/share/doc/qt/qdoc/08-qdoc-commands-creatinglinks.html
/usr/share/doc/qt/qdoc/09-qdoc-commands-includingimages.html
/usr/share/doc/qt/qdoc/10-qdoc-commands-tablesandlists.html
/usr/share/doc/qt/qdoc/11-qdoc-commands-specialcontent.html
/usr/share/doc/qt/qdoc/12-0-qdoc-commands-miscellaneous.html
/usr/share/doc/qt/qdoc/13-qdoc-commands-topics.html
/usr/share/doc/qt/qdoc/14-qdoc-commands-contextcommands.html
/usr/share/doc/qt/qdoc/15-qdoc-commands-navigation.html
/usr/share/doc/qt/qdoc/16-qdoc-commands-status.html
/usr/share/doc/qt/qdoc/17-qdoc-commands-thread.html
/usr/share/doc/qt/qdoc/18-qdoc-commands-relating.html
/usr/share/doc/qt/qdoc/19-qdoc-commands-grouping.html
/usr/share/doc/qt/qdoc/20-qdoc-commands-namingthings.html
/usr/share/doc/qt/qdoc/21-0-qdoc-configuration.html
/usr/share/doc/qt/qdoc/21-0-qdoc-creating-dita-maps.html
/usr/share/doc/qt/qdoc/21-1-minimum-qdocconf.html
/usr/share/doc/qt/qdoc/21-2-qtgui-qdocconf.html
/usr/share/doc/qt/qdoc/21-3-qt-dita-xml-output.html
/usr/share/doc/qt/qdoc/22-creating-help-project-files.html
/usr/share/doc/qt/qdoc/22-qdoc-configuration-generalvariables.html
/usr/share/doc/qt/qdoc/23-qdoc-configuration-cppvariables.html
/usr/share/doc/qt/qdoc/24-qdoc-configuration-htmlvariables.html
/usr/share/doc/qt/qdoc/25-qdoc-configuration-derivedprojects.html
/usr/share/doc/qt/qdoc/26-qdoc-configuration-example-manifest-files.html
/usr/share/doc/qt/qdoc/27-qdoc-commands-alphabetical.html
/usr/share/doc/qt/qdoc/28-qdoc-qa-pages.html
/usr/share/doc/qt/qdoc/corefeatures.html
/usr/share/doc/qt/qdoc/qdoc-categories.html
/usr/share/doc/qt/qdoc/qdoc-guide-clang.html
/usr/share/doc/qt/qdoc/qdoc-guide-conf.html
/usr/share/doc/qt/qdoc/qdoc-guide-writing.html
/usr/share/doc/qt/qdoc/qdoc-guide.html
/usr/share/doc/qt/qdoc/qdoc-index.html
/usr/share/doc/qt/qdoc/qdoc-minimum-qdocconf.html
/usr/share/doc/qt/qdoc/qdoc.index
/usr/share/doc/qt/qdoc/qdoc.qhp
/usr/share/doc/qt/qdoc/qdoc.qhp.sha1
/usr/share/doc/qt/qdoc/qdoc.tags
/usr/share/doc/qt/qdoc/qtgui-qdocconf.html
/usr/share/doc/qt/qdoc/qtwritingstyle-cpp.html
/usr/share/doc/qt/qdoc/qtwritingstyle-qml.html
/usr/share/doc/qt/qdoc/images/arrow_bc.png
/usr/share/doc/qt/qdoc/images/bgrContent.png
/usr/share/doc/qt/qdoc/images/btn_next.png
/usr/share/doc/qt/qdoc/images/btn_prev.png
/usr/share/doc/qt/qdoc/images/bullet_dn.png
/usr/share/doc/qt/qdoc/images/bullet_sq.png
/usr/share/doc/qt/qdoc/images/happy.gif
/usr/share/doc/qt/qdoc/images/happyguy.jpg
/usr/share/doc/qt/qdoc/images/home.png
/usr/share/doc/qt/qdoc/images/ico_note.png
/usr/share/doc/qt/qdoc/images/ico_note_attention.png
/usr/share/doc/qt/qdoc/images/ico_out.png
/usr/share/doc/qt/qdoc/images/link-to-qquickitem.png
/usr/share/doc/qt/qdoc/images/links-to-links.png
/usr/share/doc/qt/qdoc/images/logo.png
/usr/share/doc/qt/qdoc/images/qa-table.png
/usr/share/doc/qt/qdoc/images/training.jpg
/usr/share/doc/qt/qdoc/images/windowsvista-pushbutton.png
/usr/share/doc/qt/qdoc/style/offline-simple.css
/usr/share/doc/qt/qdoc/style/offline.css
/usr/share/doc/qt/qmake/qmake-advanced-usage.html
/usr/share/doc/qt/qmake/qmake-common-projects.html
/usr/share/doc/qt/qmake/qmake-environment-reference.html
/usr/share/doc/qt/qmake/qmake-function-reference.html
/usr/share/doc/qt/qmake/qmake-language.html
/usr/share/doc/qt/qmake/qmake-manual.html
/usr/share/doc/qt/qmake/qmake-overview.html
/usr/share/doc/qt/qmake/qmake-platform-notes.html
/usr/share/doc/qt/qmake/qmake-precompiledheaders.html
/usr/share/doc/qt/qmake/qmake-project-files.html
/usr/share/doc/qt/qmake/qmake-reference.html
/usr/share/doc/qt/qmake/qmake-running.html
/usr/share/doc/qt/qmake/qmake-test-function-reference.html
/usr/share/doc/qt/qmake/qmake-tutorial.html
/usr/share/doc/qt/qmake/qmake-variable-reference.html
/usr/share/doc/qt/qmake/qmake.index
/usr/share/doc/qt/qmake/qmake.qhp
/usr/share/doc/qt/qmake/qmake.qhp.sha1
/usr/share/doc/qt/qmake/qmake.tags
/usr/share/doc/qt/qmake/images/arrow_bc.png
/usr/share/doc/qt/qmake/images/bgrContent.png
/usr/share/doc/qt/qmake/images/btn_next.png
/usr/share/doc/qt/qmake/images/btn_prev.png
/usr/share/doc/qt/qmake/images/bullet_dn.png
/usr/share/doc/qt/qmake/images/bullet_sq.png
/usr/share/doc/qt/qmake/images/home.png
/usr/share/doc/qt/qmake/images/ico_note.png
/usr/share/doc/qt/qmake/images/ico_note_attention.png
/usr/share/doc/qt/qmake/images/ico_out.png
/usr/share/doc/qt/qmake/images/logo.png
/usr/share/doc/qt/qmake/images/qmake-precompile-ui.png
/usr/share/doc/qt/qmake/style/offline-simple.css
/usr/share/doc/qt/qmake/style/offline.css
/usr/share/doc/qt/qt3d/examples-manifest.xml
/usr/share/doc/qt/qt3d/qml-computecommand-members.html
/usr/share/doc/qt/qt3d/qml-computecommand.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-abstractanimation-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-abstractanimation.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-abstractclipanimator-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-abstractclipanimator.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-abstractclipblendnode-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-abstractclipblendnode.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-additiveclipblend-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-additiveclipblend.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-animationcontroller-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-animationcontroller.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-animationgroup-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-animationgroup.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-blendedclipanimator-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-blendedclipanimator.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-clipanimator-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-clipanimator.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-keyframeanimation-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-keyframeanimation.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-lerpblend-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-lerpblend.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-morphinganimation-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-morphinganimation.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-morphtarget-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-morphtarget.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-vertexblendanimation-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-animation-vertexblendanimation.html
/usr/share/doc/qt/qt3d/qml-qt3d-core-abstractskeleton-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-core-abstractskeleton.html
/usr/share/doc/qt/qt3d/qml-qt3d-core-armature-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-core-armature.html
/usr/share/doc/qt/qt3d/qml-qt3d-core-component3d-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-core-component3d.html
/usr/share/doc/qt/qt3d/qml-qt3d-core-entity-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-core-entity.html
/usr/share/doc/qt/qt3d/qml-qt3d-core-entityloader-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-core-entityloader.html
/usr/share/doc/qt/qt3d/qml-qt3d-core-joint-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-core-joint.html
/usr/share/doc/qt/qt3d/qml-qt3d-core-node-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-core-node.html
/usr/share/doc/qt/qt3d/qml-qt3d-core-nodeinstantiator-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-core-nodeinstantiator.html
/usr/share/doc/qt/qt3d/qml-qt3d-core-quaternionanimation-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-core-quaternionanimation.html
/usr/share/doc/qt/qt3d/qml-qt3d-core-skeleton-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-core-skeleton.html
/usr/share/doc/qt/qt3d/qml-qt3d-core-skeletonloader-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-core-skeletonloader.html
/usr/share/doc/qt/qt3d/qml-qt3d-core-transform-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-core-transform.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-conegeometry-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-conegeometry.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-conemesh-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-conemesh.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-cuboidgeometry-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-cuboidgeometry.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-cuboidmesh-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-cuboidmesh.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-cylindergeometry-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-cylindergeometry.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-cylindermesh-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-cylindermesh.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-diffusemapmaterial-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-diffusemapmaterial.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-diffusespecularmapmaterial-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-diffusespecularmapmaterial.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-diffusespecularmaterial-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-diffusespecularmaterial.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-extrudedtextgeometry-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-extrudedtextgeometry.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-extrudedtextmesh-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-extrudedtextmesh.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-firstpersoncameracontroller-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-firstpersoncameracontroller.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-forwardrenderer-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-forwardrenderer-obsolete.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-forwardrenderer.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-goochmaterial-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-goochmaterial.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-metalroughmaterial-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-metalroughmaterial.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-normaldiffusemapalphamaterial-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-normaldiffusemapalphamaterial.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-normaldiffusemapmaterial-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-normaldiffusemapmaterial.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-normaldiffusespecularmapmaterial-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-normaldiffusespecularmapmaterial.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-orbitcameracontroller-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-orbitcameracontroller.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-pervertexcolormaterial-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-pervertexcolormaterial.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-phongalphamaterial-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-phongalphamaterial.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-phongmaterial-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-phongmaterial.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-planegeometry-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-planegeometry.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-planemesh-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-planemesh.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-skyboxentity-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-skyboxentity.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-spheregeometry-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-spheregeometry.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-spheremesh-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-spheremesh.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-text2dentity-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-text2dentity.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-torusgeometry-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-torusgeometry.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-torusmesh-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-extras-torusmesh.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-abstractactioninput-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-abstractactioninput.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-abstractaxisinput-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-abstractaxisinput.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-abstractphysicaldevice-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-abstractphysicaldevice.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-action-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-action.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-actioninput-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-actioninput.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-analogaxisinput-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-analogaxisinput.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-axis-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-axis.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-axisaccumulator-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-axisaccumulator.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-axissetting-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-axissetting.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-buttonaxisinput-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-buttonaxisinput.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-inputchord-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-inputchord.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-inputsequence-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-inputsequence.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-inputsettings-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-inputsettings.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-keyboarddevice-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-keyboarddevice.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-keyboardhandler-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-keyboardhandler.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-keyevent-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-keyevent.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-logicaldevice-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-logicaldevice.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-mousedevice-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-mousedevice.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-mouseevent-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-mouseevent.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-mousehandler-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-mousehandler.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-wheelevent-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-input-wheelevent.html
/usr/share/doc/qt/qt3d/qml-qt3d-logic-frameaction-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-logic-frameaction.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-abstractraycaster-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-abstractraycaster.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-abstracttextureimage-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-abstracttextureimage.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-alphacoverage-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-alphacoverage.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-alphatest-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-alphatest.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-attribute-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-attribute.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-blendequation-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-blendequation.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-blendequationarguments-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-blendequationarguments.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-blitframebuffer-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-blitframebuffer.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-buffer-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-buffer-obsolete.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-buffer.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-camera-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-camera-obsolete.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-camera.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-cameralens-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-cameralens.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-cameraselector-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-cameraselector.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-clearbuffers-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-clearbuffers.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-clipplane-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-clipplane.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-colormask-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-colormask.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-cullface-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-cullface.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-depthtest-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-depthtest.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-directionallight-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-directionallight.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-dispatchcompute-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-dispatchcompute.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-dithering-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-dithering.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-effect-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-effect.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-environmentlight-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-environmentlight.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-filterkey-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-filterkey.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-framegraphnode-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-framegraphnode.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-frontface-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-frontface.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-frustumculling-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-frustumculling.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-geometry-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-geometry.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-geometryrenderer-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-geometryrenderer.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-graphicsapifilter-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-graphicsapifilter.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-layer-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-layer.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-layerfilter-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-layerfilter.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-levelofdetail-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-levelofdetail.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-levelofdetailboundingsphere-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-levelofdetailboundingsphere.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-levelofdetailloader-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-levelofdetailloader.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-levelofdetailswitch-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-levelofdetailswitch.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-light-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-light.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-linewidth-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-linewidth.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-material-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-material.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-memorybarrier-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-memorybarrier.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-mesh-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-mesh.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-multisampleantialiasing-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-multisampleantialiasing.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-nodepthmask-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-nodepthmask.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-nodraw-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-nodraw.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-objectpicker-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-objectpicker.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-parameter-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-parameter.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-pickevent-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-pickevent.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-pickingsettings-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-pickingsettings.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-picklineevent-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-picklineevent.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-pickpointevent-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-pickpointevent.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-picktriangleevent-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-picktriangleevent.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-pointlight-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-pointlight.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-pointsize-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-pointsize.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-polygonoffset-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-polygonoffset.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-proximityfilter-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-proximityfilter.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-raycaster-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-raycaster.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-rendercapture-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-rendercapture-obsolete.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-rendercapture.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-rendercapturereply-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-rendercapturereply-obsolete.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-rendercapturereply.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-renderpass-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-renderpass.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-renderpassfilter-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-renderpassfilter.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-rendersettings-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-rendersettings.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-renderstateset-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-renderstateset.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-rendersurfaceselector-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-rendersurfaceselector.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-rendertarget-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-rendertarget.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-rendertargetoutput-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-rendertargetoutput.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-rendertargetselector-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-rendertargetselector.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-sceneloader-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-sceneloader.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-scissortest-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-scissortest.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-screenraycaster-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-screenraycaster.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-seamlesscubemap-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-seamlesscubemap.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-shaderprogram-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-shaderprogram.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-shaderprogrambuilder-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-shaderprogrambuilder.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-sortpolicy-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-sortpolicy.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-spotlight-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-spotlight.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-stencilmask-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-stencilmask.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-stenciloperation-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-stenciloperation.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-stenciloperationarguments-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-stenciloperationarguments.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-stenciltest-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-stenciltest.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-stenciltestarguments-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-stenciltestarguments.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-technique-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-technique.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-techniquefilter-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-techniquefilter.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-textureimage-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-textureimage.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-textureloader-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-textureloader.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-viewport-members.html
/usr/share/doc/qt/qt3d/qml-qt3d-render-viewport.html
/usr/share/doc/qt/qt3d/qml-qtquick-scene2d-scene2d-members.html
/usr/share/doc/qt/qt3d/qml-qtquick-scene2d-scene2d.html
/usr/share/doc/qt/qt3d/qml-qtquick-scene3d-scene3d-members.html
/usr/share/doc/qt/qt3d/qml-qtquick-scene3d-scene3d.html
/usr/share/doc/qt/qt3d/qml-renderstate-members.html
/usr/share/doc/qt/qt3d/qml-renderstate.html
/usr/share/doc/qt/qt3d/qt3d-advancedcustommaterial-example.html
/usr/share/doc/qt/qt3d/qt3d-animation-qmlmodule.html
/usr/share/doc/qt/qt3d/qt3d-attribution-assimp.html
/usr/share/doc/qt/qt3d/qt3d-attribution-gltf-wine.html
/usr/share/doc/qt/qt3d/qt3d-attribution-miramar-sky.html
/usr/share/doc/qt/qt3d/qt3d-attribution-nasa-jpl.html
/usr/share/doc/qt/qt3d/qt3d-attribution-solar-system-scope.html
/usr/share/doc/qt/qt3d/qt3d-attribution-substance-share.html
/usr/share/doc/qt/qt3d/qt3d-audio-visualizer-qml-example.html
/usr/share/doc/qt/qt3d/qt3d-basicshapes-cpp-example.html
/usr/share/doc/qt/qt3d/qt3d-core-qmlmodule.html
/usr/share/doc/qt/qt3d/qt3d-cpp.html
/usr/share/doc/qt/qt3d/qt3d-examples.html
/usr/share/doc/qt/qt3d/qt3d-extras-qmlmodule.html
/usr/share/doc/qt/qt3d/qt3d-index.html
/usr/share/doc/qt/qt3d/qt3d-input-qmlmodule.html
/usr/share/doc/qt/qt3d/qt3d-logic-qmlmodule.html
/usr/share/doc/qt/qt3d/qt3d-multiviewport-example.html
/usr/share/doc/qt/qt3d/qt3d-overview.html
/usr/share/doc/qt/qt3d/qt3d-pbr-materials-example.html
/usr/share/doc/qt/qt3d/qt3d-planets-qml-example.html
/usr/share/doc/qt/qt3d/qt3d-qml.html
/usr/share/doc/qt/qt3d/qt3d-render-qmlmodule.html
/usr/share/doc/qt/qt3d/qt3d-scene2d-example.html
/usr/share/doc/qt/qt3d/qt3d-scene3d-example.html
/usr/share/doc/qt/qt3d/qt3d-shadow-map-qml-example.html
/usr/share/doc/qt/qt3d/qt3d-simple-cpp-example.html
/usr/share/doc/qt/qt3d/qt3d-simple-qml-example.html
/usr/share/doc/qt/qt3d/qt3d-simplecustommaterial-example.html
/usr/share/doc/qt/qt3d/qt3d-wave-example.html
/usr/share/doc/qt/qt3d/qt3d-widgets-scene3d-example.html
/usr/share/doc/qt/qt3d/qt3d-wireframe-example.html
/usr/share/doc/qt/qt3d/qt3d.index
/usr/share/doc/qt/qt3d/qt3d.qhp
/usr/share/doc/qt/qt3d/qt3d.qhp.sha1
/usr/share/doc/qt/qt3d/qt3d.tags
/usr/share/doc/qt/qt3d/qt3danimation-module.html
/usr/share/doc/qt/qt3d/qt3danimation-qabstractanimation-members.html
/usr/share/doc/qt/qt3d/qt3danimation-qabstractanimation.html
/usr/share/doc/qt/qt3d/qt3danimation-qabstractanimationclip-members.html
/usr/share/doc/qt/qt3d/qt3danimation-qabstractanimationclip.html
/usr/share/doc/qt/qt3d/qt3danimation-qabstractclipanimator-members.html
/usr/share/doc/qt/qt3d/qt3danimation-qabstractclipanimator.html
/usr/share/doc/qt/qt3d/qt3danimation-qabstractclipblendnode-members.html
/usr/share/doc/qt/qt3d/qt3danimation-qabstractclipblendnode.html
/usr/share/doc/qt/qt3d/qt3danimation-qadditiveclipblend-members.html
/usr/share/doc/qt/qt3d/qt3danimation-qadditiveclipblend.html
/usr/share/doc/qt/qt3d/qt3danimation-qanimationaspect-members.html
/usr/share/doc/qt/qt3d/qt3danimation-qanimationaspect.html
/usr/share/doc/qt/qt3d/qt3danimation-qanimationcliploader-members.html
/usr/share/doc/qt/qt3d/qt3danimation-qanimationcliploader.html
/usr/share/doc/qt/qt3d/qt3danimation-qanimationcontroller-members.html
/usr/share/doc/qt/qt3d/qt3danimation-qanimationcontroller.html
/usr/share/doc/qt/qt3d/qt3danimation-qanimationgroup-members.html
/usr/share/doc/qt/qt3d/qt3danimation-qanimationgroup.html
/usr/share/doc/qt/qt3d/qt3danimation-qblendedclipanimator-members.html
/usr/share/doc/qt/qt3d/qt3danimation-qblendedclipanimator.html
/usr/share/doc/qt/qt3d/qt3danimation-qchannelmappingcreatedchangebase-members.html
/usr/share/doc/qt/qt3d/qt3danimation-qchannelmappingcreatedchangebase.html
/usr/share/doc/qt/qt3d/qt3danimation-qclipanimator-members.html
/usr/share/doc/qt/qt3d/qt3danimation-qclipanimator.html
/usr/share/doc/qt/qt3d/qt3danimation-qclipblendnodecreatedchangebase-members.html
/usr/share/doc/qt/qt3d/qt3danimation-qclipblendnodecreatedchangebase.html
/usr/share/doc/qt/qt3d/qt3danimation-qkeyframe.html
/usr/share/doc/qt/qt3d/qt3danimation-qkeyframeanimation-members.html
/usr/share/doc/qt/qt3d/qt3danimation-qkeyframeanimation.html
/usr/share/doc/qt/qt3d/qt3danimation-qlerpclipblend-members.html
/usr/share/doc/qt/qt3d/qt3danimation-qlerpclipblend.html
/usr/share/doc/qt/qt3d/qt3danimation-qmorphinganimation-members.html
/usr/share/doc/qt/qt3d/qt3danimation-qmorphinganimation.html
/usr/share/doc/qt/qt3d/qt3danimation-qmorphtarget-members.html
/usr/share/doc/qt/qt3d/qt3danimation-qmorphtarget.html
/usr/share/doc/qt/qt3d/qt3danimation-qvertexblendanimation-members.html
/usr/share/doc/qt/qt3d/qt3danimation-qvertexblendanimation.html
/usr/share/doc/qt/qt3d/qt3danimation.html
/usr/share/doc/qt/qt3d/qt3dcore-module.html
/usr/share/doc/qt/qt3d/qt3dcore-qabstractaspect-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qabstractaspect.html
/usr/share/doc/qt/qt3d/qt3dcore-qabstractskeleton-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qabstractskeleton.html
/usr/share/doc/qt/qt3d/qt3dcore-qarmature-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qarmature.html
/usr/share/doc/qt/qt3d/qt3dcore-qaspectengine-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qaspectengine.html
/usr/share/doc/qt/qt3d/qt3dcore-qaspectjob-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qaspectjob.html
/usr/share/doc/qt/qt3d/qt3dcore-qbackendnode-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qbackendnode.html
/usr/share/doc/qt/qt3d/qt3dcore-qbackendnodemapper-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qbackendnodemapper.html
/usr/share/doc/qt/qt3d/qt3dcore-qcomponent-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qcomponent.html
/usr/share/doc/qt/qt3d/qt3dcore-qcomponentaddedchange-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qcomponentaddedchange.html
/usr/share/doc/qt/qt3d/qt3dcore-qcomponentremovedchange-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qcomponentremovedchange.html
/usr/share/doc/qt/qt3d/qt3dcore-qdynamicpropertyupdatedchange-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qdynamicpropertyupdatedchange.html
/usr/share/doc/qt/qt3d/qt3dcore-qentity-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qentity.html
/usr/share/doc/qt/qt3d/qt3dcore-qjoint-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qjoint.html
/usr/share/doc/qt/qt3d/qt3dcore-qnode-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qnode.html
/usr/share/doc/qt/qt3d/qt3dcore-qnodecommand-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qnodecommand.html
/usr/share/doc/qt/qt3d/qt3dcore-qnodecreatedchange-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qnodecreatedchange.html
/usr/share/doc/qt/qt3d/qt3dcore-qnodecreatedchangebase-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qnodecreatedchangebase.html
/usr/share/doc/qt/qt3d/qt3dcore-qnodedestroyedchange-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qnodedestroyedchange.html
/usr/share/doc/qt/qt3d/qt3dcore-qnodeid-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qnodeid.html
/usr/share/doc/qt/qt3d/qt3dcore-qpropertynodeaddedchange-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qpropertynodeaddedchange.html
/usr/share/doc/qt/qt3d/qt3dcore-qpropertynoderemovedchange-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qpropertynoderemovedchange.html
/usr/share/doc/qt/qt3d/qt3dcore-qpropertyupdatedchange-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qpropertyupdatedchange.html
/usr/share/doc/qt/qt3d/qt3dcore-qpropertyupdatedchangebase-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qpropertyupdatedchangebase.html
/usr/share/doc/qt/qt3d/qt3dcore-qpropertyvalueaddedchange-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qpropertyvalueaddedchange.html
/usr/share/doc/qt/qt3d/qt3dcore-qpropertyvalueaddedchangebase-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qpropertyvalueaddedchangebase.html
/usr/share/doc/qt/qt3d/qt3dcore-qpropertyvalueremovedchange-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qpropertyvalueremovedchange.html
/usr/share/doc/qt/qt3d/qt3dcore-qpropertyvalueremovedchangebase-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qpropertyvalueremovedchangebase.html
/usr/share/doc/qt/qt3d/qt3dcore-qscenechange-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qscenechange.html
/usr/share/doc/qt/qt3d/qt3dcore-qskeleton-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qskeleton.html
/usr/share/doc/qt/qt3d/qt3dcore-qskeletonloader-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qskeletonloader.html
/usr/share/doc/qt/qt3d/qt3dcore-qstaticpropertyupdatedchangebase-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qstaticpropertyupdatedchangebase.html
/usr/share/doc/qt/qt3d/qt3dcore-qstaticpropertyvalueaddedchangebase-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qstaticpropertyvalueaddedchangebase.html
/usr/share/doc/qt/qt3d/qt3dcore-qstaticpropertyvalueremovedchangebase-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qstaticpropertyvalueremovedchangebase.html
/usr/share/doc/qt/qt3d/qt3dcore-qtransform-members.html
/usr/share/doc/qt/qt3d/qt3dcore-qtransform.html
/usr/share/doc/qt/qt3d/qt3dcore-quick-qqmlaspectengine-members.html
/usr/share/doc/qt/qt3d/qt3dcore-quick-qqmlaspectengine.html
/usr/share/doc/qt/qt3d/qt3dcore-quick.html
/usr/share/doc/qt/qt3d/qt3dcore.html
/usr/share/doc/qt/qt3d/qt3dextras-module.html
/usr/share/doc/qt/qt3d/qt3dextras-obsolete.html
/usr/share/doc/qt/qt3d/qt3dextras-qabstractcameracontroller-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qabstractcameracontroller.html
/usr/share/doc/qt/qt3d/qt3dextras-qconegeometry-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qconegeometry.html
/usr/share/doc/qt/qt3d/qt3dextras-qconemesh-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qconemesh.html
/usr/share/doc/qt/qt3d/qt3dextras-qcuboidgeometry-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qcuboidgeometry.html
/usr/share/doc/qt/qt3d/qt3dextras-qcuboidmesh-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qcuboidmesh.html
/usr/share/doc/qt/qt3d/qt3dextras-qcylindergeometry-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qcylindergeometry.html
/usr/share/doc/qt/qt3d/qt3dextras-qcylindermesh-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qcylindermesh.html
/usr/share/doc/qt/qt3d/qt3dextras-qdiffusemapmaterial-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qdiffusemapmaterial.html
/usr/share/doc/qt/qt3d/qt3dextras-qdiffusespecularmapmaterial-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qdiffusespecularmapmaterial.html
/usr/share/doc/qt/qt3d/qt3dextras-qdiffusespecularmaterial-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qdiffusespecularmaterial.html
/usr/share/doc/qt/qt3d/qt3dextras-qextrudedtextgeometry-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qextrudedtextgeometry.html
/usr/share/doc/qt/qt3d/qt3dextras-qextrudedtextmesh-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qextrudedtextmesh.html
/usr/share/doc/qt/qt3d/qt3dextras-qfirstpersoncameracontroller-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qfirstpersoncameracontroller.html
/usr/share/doc/qt/qt3d/qt3dextras-qforwardrenderer-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qforwardrenderer-obsolete.html
/usr/share/doc/qt/qt3d/qt3dextras-qforwardrenderer.html
/usr/share/doc/qt/qt3d/qt3dextras-qgoochmaterial-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qgoochmaterial.html
/usr/share/doc/qt/qt3d/qt3dextras-qmetalroughmaterial-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qmetalroughmaterial.html
/usr/share/doc/qt/qt3d/qt3dextras-qmorphphongmaterial-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qmorphphongmaterial.html
/usr/share/doc/qt/qt3d/qt3dextras-qnormaldiffusemapalphamaterial-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qnormaldiffusemapalphamaterial.html
/usr/share/doc/qt/qt3d/qt3dextras-qnormaldiffusemapmaterial-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qnormaldiffusemapmaterial.html
/usr/share/doc/qt/qt3d/qt3dextras-qnormaldiffusespecularmapmaterial-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qnormaldiffusespecularmapmaterial.html
/usr/share/doc/qt/qt3d/qt3dextras-qorbitcameracontroller-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qorbitcameracontroller.html
/usr/share/doc/qt/qt3d/qt3dextras-qpervertexcolormaterial-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qpervertexcolormaterial.html
/usr/share/doc/qt/qt3d/qt3dextras-qphongalphamaterial-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qphongalphamaterial.html
/usr/share/doc/qt/qt3d/qt3dextras-qphongmaterial-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qphongmaterial.html
/usr/share/doc/qt/qt3d/qt3dextras-qplanegeometry-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qplanegeometry.html
/usr/share/doc/qt/qt3d/qt3dextras-qplanemesh-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qplanemesh.html
/usr/share/doc/qt/qt3d/qt3dextras-qskyboxentity-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qskyboxentity.html
/usr/share/doc/qt/qt3d/qt3dextras-qspheregeometry-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qspheregeometry.html
/usr/share/doc/qt/qt3d/qt3dextras-qspheremesh-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qspheremesh.html
/usr/share/doc/qt/qt3d/qt3dextras-qtext2dentity-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qtext2dentity.html
/usr/share/doc/qt/qt3d/qt3dextras-qtexturedmetalroughmaterial-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qtexturedmetalroughmaterial.html
/usr/share/doc/qt/qt3d/qt3dextras-qtexturematerial-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qtexturematerial.html
/usr/share/doc/qt/qt3d/qt3dextras-qtorusgeometry-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qtorusgeometry.html
/usr/share/doc/qt/qt3d/qt3dextras-qtorusmesh-members.html
/usr/share/doc/qt/qt3d/qt3dextras-qtorusmesh.html
/usr/share/doc/qt/qt3d/qt3dextras.html
/usr/share/doc/qt/qt3d/qt3dinput-module.html
/usr/share/doc/qt/qt3d/qt3dinput-qabstractactioninput-members.html
/usr/share/doc/qt/qt3d/qt3dinput-qabstractactioninput.html
/usr/share/doc/qt/qt3d/qt3dinput-qabstractaxisinput-members.html
/usr/share/doc/qt/qt3d/qt3dinput-qabstractaxisinput.html
/usr/share/doc/qt/qt3d/qt3dinput-qabstractphysicaldevice-members.html
/usr/share/doc/qt/qt3d/qt3dinput-qabstractphysicaldevice.html
/usr/share/doc/qt/qt3d/qt3dinput-qabstractphysicaldeviceproxy-members.html
/usr/share/doc/qt/qt3d/qt3dinput-qabstractphysicaldeviceproxy.html
/usr/share/doc/qt/qt3d/qt3dinput-qaction-members.html
/usr/share/doc/qt/qt3d/qt3dinput-qaction.html
/usr/share/doc/qt/qt3d/qt3dinput-qactioninput-members.html
/usr/share/doc/qt/qt3d/qt3dinput-qactioninput.html
/usr/share/doc/qt/qt3d/qt3dinput-qanalogaxisinput-members.html
/usr/share/doc/qt/qt3d/qt3dinput-qanalogaxisinput.html
/usr/share/doc/qt/qt3d/qt3dinput-qaxis-members.html
/usr/share/doc/qt/qt3d/qt3dinput-qaxis.html
/usr/share/doc/qt/qt3d/qt3dinput-qaxisaccumulator-members.html
/usr/share/doc/qt/qt3d/qt3dinput-qaxisaccumulator.html
/usr/share/doc/qt/qt3d/qt3dinput-qaxissetting-members.html
/usr/share/doc/qt/qt3d/qt3dinput-qaxissetting.html
/usr/share/doc/qt/qt3d/qt3dinput-qbuttonaxisinput-members.html
/usr/share/doc/qt/qt3d/qt3dinput-qbuttonaxisinput.html
/usr/share/doc/qt/qt3d/qt3dinput-qinputaspect-members.html
/usr/share/doc/qt/qt3d/qt3dinput-qinputaspect.html
/usr/share/doc/qt/qt3d/qt3dinput-qinputchord-members.html
/usr/share/doc/qt/qt3d/qt3dinput-qinputchord.html
/usr/share/doc/qt/qt3d/qt3dinput-qinputdeviceintegration-members.html
/usr/share/doc/qt/qt3d/qt3dinput-qinputdeviceintegration.html
/usr/share/doc/qt/qt3d/qt3dinput-qinputsequence-members.html
/usr/share/doc/qt/qt3d/qt3dinput-qinputsequence.html
/usr/share/doc/qt/qt3d/qt3dinput-qinputsettings-members.html
/usr/share/doc/qt/qt3d/qt3dinput-qinputsettings.html
/usr/share/doc/qt/qt3d/qt3dinput-qkeyboarddevice-members.html
/usr/share/doc/qt/qt3d/qt3dinput-qkeyboarddevice.html
/usr/share/doc/qt/qt3d/qt3dinput-qkeyboardhandler-members.html
/usr/share/doc/qt/qt3d/qt3dinput-qkeyboardhandler.html
/usr/share/doc/qt/qt3d/qt3dinput-qkeyevent-members.html
/usr/share/doc/qt/qt3d/qt3dinput-qkeyevent.html
/usr/share/doc/qt/qt3d/qt3dinput-qlogicaldevice-members.html
/usr/share/doc/qt/qt3d/qt3dinput-qlogicaldevice.html
/usr/share/doc/qt/qt3d/qt3dinput-qmousedevice-members.html
/usr/share/doc/qt/qt3d/qt3dinput-qmousedevice.html
/usr/share/doc/qt/qt3d/qt3dinput-qmouseevent-members.html
/usr/share/doc/qt/qt3d/qt3dinput-qmouseevent.html
/usr/share/doc/qt/qt3d/qt3dinput-qmousehandler-members.html
/usr/share/doc/qt/qt3d/qt3dinput-qmousehandler.html
/usr/share/doc/qt/qt3d/qt3dinput-qwheelevent-members.html
/usr/share/doc/qt/qt3d/qt3dinput-qwheelevent.html
/usr/share/doc/qt/qt3d/qt3dinput.html
/usr/share/doc/qt/qt3d/qt3dlogic-logic.html
/usr/share/doc/qt/qt3d/qt3dlogic-module.html
/usr/share/doc/qt/qt3d/qt3dlogic-qframeaction-members.html
/usr/share/doc/qt/qt3d/qt3dlogic-qframeaction.html
/usr/share/doc/qt/qt3d/qt3dlogic-qlogicaspect-members.html
/usr/share/doc/qt/qt3d/qt3dlogic-qlogicaspect.html
/usr/share/doc/qt/qt3d/qt3dlogic.html
/usr/share/doc/qt/qt3d/qt3drender-framegraph.html
/usr/share/doc/qt/qt3d/qt3drender-geometry.html
/usr/share/doc/qt/qt3d/qt3drender-module.html
/usr/share/doc/qt/qt3d/qt3drender-protips.html
/usr/share/doc/qt/qt3d/qt3drender-qabstractfunctor-members.html
/usr/share/doc/qt/qt3d/qt3drender-qabstractfunctor.html
/usr/share/doc/qt/qt3d/qt3drender-qabstractlight-members.html
/usr/share/doc/qt/qt3d/qt3drender-qabstractlight.html
/usr/share/doc/qt/qt3d/qt3drender-qabstractraycaster-members.html
/usr/share/doc/qt/qt3d/qt3drender-qabstractraycaster.html
/usr/share/doc/qt/qt3d/qt3drender-qabstracttexture-members.html
/usr/share/doc/qt/qt3d/qt3drender-qabstracttexture.html
/usr/share/doc/qt/qt3d/qt3drender-qabstracttextureimage-members.html
/usr/share/doc/qt/qt3d/qt3drender-qabstracttextureimage.html
/usr/share/doc/qt/qt3d/qt3drender-qalphacoverage-members.html
/usr/share/doc/qt/qt3d/qt3drender-qalphacoverage.html
/usr/share/doc/qt/qt3d/qt3drender-qalphatest-members.html
/usr/share/doc/qt/qt3d/qt3drender-qalphatest.html
/usr/share/doc/qt/qt3d/qt3drender-qattribute-members.html
/usr/share/doc/qt/qt3d/qt3drender-qattribute.html
/usr/share/doc/qt/qt3d/qt3drender-qblendequation-members.html
/usr/share/doc/qt/qt3d/qt3drender-qblendequation.html
/usr/share/doc/qt/qt3d/qt3drender-qblendequationarguments-members.html
/usr/share/doc/qt/qt3d/qt3drender-qblendequationarguments.html
/usr/share/doc/qt/qt3d/qt3drender-qblitframebuffer-members.html
/usr/share/doc/qt/qt3d/qt3drender-qblitframebuffer.html
/usr/share/doc/qt/qt3d/qt3drender-qbuffer-members.html
/usr/share/doc/qt/qt3d/qt3drender-qbuffer-obsolete.html
/usr/share/doc/qt/qt3d/qt3drender-qbuffer.html
/usr/share/doc/qt/qt3d/qt3drender-qbuffercapture-members.html
/usr/share/doc/qt/qt3d/qt3drender-qbuffercapture.html
/usr/share/doc/qt/qt3d/qt3drender-qbufferdatagenerator-members.html
/usr/share/doc/qt/qt3d/qt3drender-qbufferdatagenerator.html
/usr/share/doc/qt/qt3d/qt3drender-qcamera-members.html
/usr/share/doc/qt/qt3d/qt3drender-qcamera-obsolete.html
/usr/share/doc/qt/qt3d/qt3drender-qcamera.html
/usr/share/doc/qt/qt3d/qt3drender-qcameralens-members.html
/usr/share/doc/qt/qt3d/qt3drender-qcameralens.html
/usr/share/doc/qt/qt3d/qt3drender-qcameraselector-members.html
/usr/share/doc/qt/qt3d/qt3drender-qcameraselector.html
/usr/share/doc/qt/qt3d/qt3drender-qclearbuffers-members.html
/usr/share/doc/qt/qt3d/qt3drender-qclearbuffers.html
/usr/share/doc/qt/qt3d/qt3drender-qclipplane-members.html
/usr/share/doc/qt/qt3d/qt3drender-qclipplane.html
/usr/share/doc/qt/qt3d/qt3drender-qcolormask-members.html
/usr/share/doc/qt/qt3d/qt3drender-qcolormask.html
/usr/share/doc/qt/qt3d/qt3drender-qcomputecommand-members.html
/usr/share/doc/qt/qt3d/qt3drender-qcomputecommand.html
/usr/share/doc/qt/qt3d/qt3drender-qcullface-members.html
/usr/share/doc/qt/qt3d/qt3drender-qcullface.html
/usr/share/doc/qt/qt3d/qt3drender-qdepthtest-members.html
/usr/share/doc/qt/qt3d/qt3drender-qdepthtest.html
/usr/share/doc/qt/qt3d/qt3drender-qdirectionallight-members.html
/usr/share/doc/qt/qt3d/qt3drender-qdirectionallight.html
/usr/share/doc/qt/qt3d/qt3drender-qdispatchcompute-members.html
/usr/share/doc/qt/qt3d/qt3drender-qdispatchcompute.html
/usr/share/doc/qt/qt3d/qt3drender-qdithering-members.html
/usr/share/doc/qt/qt3d/qt3drender-qdithering.html
/usr/share/doc/qt/qt3d/qt3drender-qeffect-members.html
/usr/share/doc/qt/qt3d/qt3drender-qeffect.html
/usr/share/doc/qt/qt3d/qt3drender-qenvironmentlight-members.html
/usr/share/doc/qt/qt3d/qt3drender-qenvironmentlight.html
/usr/share/doc/qt/qt3d/qt3drender-qfilterkey-members.html
/usr/share/doc/qt/qt3d/qt3drender-qfilterkey.html
/usr/share/doc/qt/qt3d/qt3drender-qframegraphnode-members.html
/usr/share/doc/qt/qt3d/qt3drender-qframegraphnode.html
/usr/share/doc/qt/qt3d/qt3drender-qframegraphnodecreatedchangebase-members.html
/usr/share/doc/qt/qt3d/qt3drender-qframegraphnodecreatedchangebase.html
/usr/share/doc/qt/qt3d/qt3drender-qfrontface-members.html
/usr/share/doc/qt/qt3d/qt3drender-qfrontface.html
/usr/share/doc/qt/qt3d/qt3drender-qfrustumculling-members.html
/usr/share/doc/qt/qt3d/qt3drender-qfrustumculling.html
/usr/share/doc/qt/qt3d/qt3drender-qgeometry-members.html
/usr/share/doc/qt/qt3d/qt3drender-qgeometry.html
/usr/share/doc/qt/qt3d/qt3drender-qgeometryrenderer-members.html
/usr/share/doc/qt/qt3d/qt3drender-qgeometryrenderer.html
/usr/share/doc/qt/qt3d/qt3drender-qgraphicsapifilter-members.html
/usr/share/doc/qt/qt3d/qt3drender-qgraphicsapifilter.html
/usr/share/doc/qt/qt3d/qt3drender-qlayer-members.html
/usr/share/doc/qt/qt3d/qt3drender-qlayer.html
/usr/share/doc/qt/qt3d/qt3drender-qlayerfilter-members.html
/usr/share/doc/qt/qt3d/qt3drender-qlayerfilter.html
/usr/share/doc/qt/qt3d/qt3drender-qlevelofdetail-members.html
/usr/share/doc/qt/qt3d/qt3drender-qlevelofdetail.html
/usr/share/doc/qt/qt3d/qt3drender-qlevelofdetailboundingsphere-members.html
/usr/share/doc/qt/qt3d/qt3drender-qlevelofdetailboundingsphere.html
/usr/share/doc/qt/qt3d/qt3drender-qlevelofdetailswitch-members.html
/usr/share/doc/qt/qt3d/qt3drender-qlevelofdetailswitch.html
/usr/share/doc/qt/qt3d/qt3drender-qlinewidth-members.html
/usr/share/doc/qt/qt3d/qt3drender-qlinewidth.html
/usr/share/doc/qt/qt3d/qt3drender-qmaterial-members.html
/usr/share/doc/qt/qt3d/qt3drender-qmaterial.html
/usr/share/doc/qt/qt3d/qt3drender-qmemorybarrier-members.html
/usr/share/doc/qt/qt3d/qt3drender-qmemorybarrier.html
/usr/share/doc/qt/qt3d/qt3drender-qmesh-members.html
/usr/share/doc/qt/qt3d/qt3drender-qmesh.html
/usr/share/doc/qt/qt3d/qt3drender-qmultisampleantialiasing-members.html
/usr/share/doc/qt/qt3d/qt3drender-qmultisampleantialiasing.html
/usr/share/doc/qt/qt3d/qt3drender-qnodepthmask-members.html
/usr/share/doc/qt/qt3d/qt3drender-qnodepthmask.html
/usr/share/doc/qt/qt3d/qt3drender-qnodraw-members.html
/usr/share/doc/qt/qt3d/qt3drender-qnodraw.html
/usr/share/doc/qt/qt3d/qt3drender-qobjectpicker-members.html
/usr/share/doc/qt/qt3d/qt3drender-qobjectpicker.html
/usr/share/doc/qt/qt3d/qt3drender-qpaintedtextureimage-members.html
/usr/share/doc/qt/qt3d/qt3drender-qpaintedtextureimage.html
/usr/share/doc/qt/qt3d/qt3drender-qparameter-members.html
/usr/share/doc/qt/qt3d/qt3drender-qparameter.html
/usr/share/doc/qt/qt3d/qt3drender-qpickevent-members.html
/usr/share/doc/qt/qt3d/qt3drender-qpickevent.html
/usr/share/doc/qt/qt3d/qt3drender-qpickingsettings-members.html
/usr/share/doc/qt/qt3d/qt3drender-qpickingsettings.html
/usr/share/doc/qt/qt3d/qt3drender-qpicklineevent-members.html
/usr/share/doc/qt/qt3d/qt3drender-qpicklineevent.html
/usr/share/doc/qt/qt3d/qt3drender-qpickpointevent-members.html
/usr/share/doc/qt/qt3d/qt3drender-qpickpointevent.html
/usr/share/doc/qt/qt3d/qt3drender-qpicktriangleevent-members.html
/usr/share/doc/qt/qt3d/qt3drender-qpicktriangleevent.html
/usr/share/doc/qt/qt3d/qt3drender-qpointlight-members.html
/usr/share/doc/qt/qt3d/qt3drender-qpointlight.html
/usr/share/doc/qt/qt3d/qt3drender-qpointsize-members.html
/usr/share/doc/qt/qt3d/qt3drender-qpointsize.html
/usr/share/doc/qt/qt3d/qt3drender-qpolygonoffset-members.html
/usr/share/doc/qt/qt3d/qt3drender-qpolygonoffset.html
/usr/share/doc/qt/qt3d/qt3drender-qproximityfilter-members.html
/usr/share/doc/qt/qt3d/qt3drender-qproximityfilter.html
/usr/share/doc/qt/qt3d/qt3drender-qraycaster-members.html
/usr/share/doc/qt/qt3d/qt3drender-qraycaster.html
/usr/share/doc/qt/qt3d/qt3drender-qraycasterhit-members.html
/usr/share/doc/qt/qt3d/qt3drender-qraycasterhit.html
/usr/share/doc/qt/qt3d/qt3drender-qrenderaspect-members.html
/usr/share/doc/qt/qt3d/qt3drender-qrenderaspect.html
/usr/share/doc/qt/qt3d/qt3drender-qrendercapture-members.html
/usr/share/doc/qt/qt3d/qt3drender-qrendercapture-obsolete.html
/usr/share/doc/qt/qt3d/qt3drender-qrendercapture.html
/usr/share/doc/qt/qt3d/qt3drender-qrendercapturereply-members.html
/usr/share/doc/qt/qt3d/qt3drender-qrendercapturereply-obsolete.html
/usr/share/doc/qt/qt3d/qt3drender-qrendercapturereply.html
/usr/share/doc/qt/qt3d/qt3drender-qrenderpass-members.html
/usr/share/doc/qt/qt3d/qt3drender-qrenderpass.html
/usr/share/doc/qt/qt3d/qt3drender-qrenderpassfilter-members.html
/usr/share/doc/qt/qt3d/qt3drender-qrenderpassfilter.html
/usr/share/doc/qt/qt3d/qt3drender-qrendersettings-members.html
/usr/share/doc/qt/qt3d/qt3drender-qrendersettings.html
/usr/share/doc/qt/qt3d/qt3drender-qrenderstate-members.html
/usr/share/doc/qt/qt3d/qt3drender-qrenderstate.html
/usr/share/doc/qt/qt3d/qt3drender-qrenderstateset-members.html
/usr/share/doc/qt/qt3d/qt3drender-qrenderstateset.html
/usr/share/doc/qt/qt3d/qt3drender-qrendersurfaceselector-members.html
/usr/share/doc/qt/qt3d/qt3drender-qrendersurfaceselector.html
/usr/share/doc/qt/qt3d/qt3drender-qrendertarget-members.html
/usr/share/doc/qt/qt3d/qt3drender-qrendertarget.html
/usr/share/doc/qt/qt3d/qt3drender-qrendertargetoutput-members.html
/usr/share/doc/qt/qt3d/qt3drender-qrendertargetoutput.html
/usr/share/doc/qt/qt3d/qt3drender-qrendertargetselector-members.html
/usr/share/doc/qt/qt3d/qt3drender-qrendertargetselector.html
/usr/share/doc/qt/qt3d/qt3drender-qsceneloader-members.html
/usr/share/doc/qt/qt3d/qt3drender-qsceneloader.html
/usr/share/doc/qt/qt3d/qt3drender-qscissortest-members.html
/usr/share/doc/qt/qt3d/qt3drender-qscissortest.html
/usr/share/doc/qt/qt3d/qt3drender-qscreenraycaster-members.html
/usr/share/doc/qt/qt3d/qt3drender-qscreenraycaster.html
/usr/share/doc/qt/qt3d/qt3drender-qseamlesscubemap-members.html
/usr/share/doc/qt/qt3d/qt3drender-qseamlesscubemap.html
/usr/share/doc/qt/qt3d/qt3drender-qshaderdata-members.html
/usr/share/doc/qt/qt3d/qt3drender-qshaderdata.html
/usr/share/doc/qt/qt3d/qt3drender-qshaderprogram-members.html
/usr/share/doc/qt/qt3d/qt3drender-qshaderprogram.html
/usr/share/doc/qt/qt3d/qt3drender-qshaderprogrambuilder-members.html
/usr/share/doc/qt/qt3d/qt3drender-qshaderprogrambuilder.html
/usr/share/doc/qt/qt3d/qt3drender-qsharedgltexture-members.html
/usr/share/doc/qt/qt3d/qt3drender-qsharedgltexture.html
/usr/share/doc/qt/qt3d/qt3drender-qsortpolicy-members.html
/usr/share/doc/qt/qt3d/qt3drender-qsortpolicy.html
/usr/share/doc/qt/qt3d/qt3drender-qspotlight-members.html
/usr/share/doc/qt/qt3d/qt3drender-qspotlight.html
/usr/share/doc/qt/qt3d/qt3drender-qstencilmask-members.html
/usr/share/doc/qt/qt3d/qt3drender-qstencilmask.html
/usr/share/doc/qt/qt3d/qt3drender-qstenciloperation-members.html
/usr/share/doc/qt/qt3d/qt3drender-qstenciloperation.html
/usr/share/doc/qt/qt3d/qt3drender-qstenciloperationarguments-members.html
/usr/share/doc/qt/qt3d/qt3drender-qstenciloperationarguments.html
/usr/share/doc/qt/qt3d/qt3drender-qstenciltest-members.html
/usr/share/doc/qt/qt3d/qt3drender-qstenciltest.html
/usr/share/doc/qt/qt3d/qt3drender-qstenciltestarguments-members.html
/usr/share/doc/qt/qt3d/qt3drender-qstenciltestarguments.html
/usr/share/doc/qt/qt3d/qt3drender-qtechnique-members.html
/usr/share/doc/qt/qt3d/qt3drender-qtechnique.html
/usr/share/doc/qt/qt3d/qt3drender-qtechniquefilter-members.html
/usr/share/doc/qt/qt3d/qt3drender-qtechniquefilter.html
/usr/share/doc/qt/qt3d/qt3drender-qtexture1d-members.html
/usr/share/doc/qt/qt3d/qt3drender-qtexture1d.html
/usr/share/doc/qt/qt3d/qt3drender-qtexture1darray-members.html
/usr/share/doc/qt/qt3d/qt3drender-qtexture1darray.html
/usr/share/doc/qt/qt3d/qt3drender-qtexture2d-members.html
/usr/share/doc/qt/qt3d/qt3drender-qtexture2d.html
/usr/share/doc/qt/qt3d/qt3drender-qtexture2darray-members.html
/usr/share/doc/qt/qt3d/qt3drender-qtexture2darray.html
/usr/share/doc/qt/qt3d/qt3drender-qtexture2dmultisample-members.html
/usr/share/doc/qt/qt3d/qt3drender-qtexture2dmultisample.html
/usr/share/doc/qt/qt3d/qt3drender-qtexture2dmultisamplearray-members.html
/usr/share/doc/qt/qt3d/qt3drender-qtexture2dmultisamplearray.html
/usr/share/doc/qt/qt3d/qt3drender-qtexture3d-members.html
/usr/share/doc/qt/qt3d/qt3drender-qtexture3d.html
/usr/share/doc/qt/qt3d/qt3drender-qtexturebuffer-members.html
/usr/share/doc/qt/qt3d/qt3drender-qtexturebuffer.html
/usr/share/doc/qt/qt3d/qt3drender-qtexturecubemap-members.html
/usr/share/doc/qt/qt3d/qt3drender-qtexturecubemap.html
/usr/share/doc/qt/qt3d/qt3drender-qtexturecubemaparray-members.html
/usr/share/doc/qt/qt3d/qt3drender-qtexturecubemaparray.html
/usr/share/doc/qt/qt3d/qt3drender-qtexturedata-members.html
/usr/share/doc/qt/qt3d/qt3drender-qtexturedata.html
/usr/share/doc/qt/qt3d/qt3drender-qtextureimage-members.html
/usr/share/doc/qt/qt3d/qt3drender-qtextureimage.html
/usr/share/doc/qt/qt3d/qt3drender-qtextureimagedata-members.html
/usr/share/doc/qt/qt3d/qt3drender-qtextureimagedata.html
/usr/share/doc/qt/qt3d/qt3drender-qtextureimagedatagenerator-members.html
/usr/share/doc/qt/qt3d/qt3drender-qtextureimagedatagenerator.html
/usr/share/doc/qt/qt3d/qt3drender-qtextureloader-members.html
/usr/share/doc/qt/qt3d/qt3drender-qtextureloader.html
/usr/share/doc/qt/qt3d/qt3drender-qtexturerectangle-members.html
/usr/share/doc/qt/qt3d/qt3drender-qtexturerectangle.html
/usr/share/doc/qt/qt3d/qt3drender-qtexturewrapmode-members.html
/usr/share/doc/qt/qt3d/qt3drender-qtexturewrapmode.html
/usr/share/doc/qt/qt3d/qt3drender-quick-qscene2d-members.html
/usr/share/doc/qt/qt3d/qt3drender-quick-qscene2d.html
/usr/share/doc/qt/qt3d/qt3drender-quick-sub-qt3d.html
/usr/share/doc/qt/qt3d/qt3drender-qviewport-members.html
/usr/share/doc/qt/qt3d/qt3drender-qviewport.html
/usr/share/doc/qt/qt3d/qt3drender-render.html
/usr/share/doc/qt/qt3d/qt3drender.html
/usr/share/doc/qt/qt3d/qt3dscene2d-module.html
/usr/share/doc/qt/qt3d/qtquick-scene2d-qmlmodule.html
/usr/share/doc/qt/qt3d/qtquick-scene3d-qmlmodule.html
/usr/share/doc/qt/qt3d/images/Space-invaders.jpg
/usr/share/doc/qt/qt3d/images/advanced-custom-material.jpg
/usr/share/doc/qt/qt3d/images/arrow_bc.png
/usr/share/doc/qt/qt3d/images/audio-visualizer-qml-example.png
/usr/share/doc/qt/qt3d/images/basicshapes-cpp-example.jpg
/usr/share/doc/qt/qt3d/images/bgrContent.png
/usr/share/doc/qt/qt3d/images/btn_next.png
/usr/share/doc/qt/qt3d/images/btn_prev.png
/usr/share/doc/qt/qt3d/images/bullet_dn.png
/usr/share/doc/qt/qt3d/images/bullet_sq.png
/usr/share/doc/qt/qt3d/images/deferred-framegraph.png
/usr/share/doc/qt/qt3d/images/ecs-1.png
/usr/share/doc/qt/qt3d/images/ecs-2.png
/usr/share/doc/qt/qt3d/images/framegraph-parallel-build.png
/usr/share/doc/qt/qt3d/images/home.png
/usr/share/doc/qt/qt3d/images/ico_note.png
/usr/share/doc/qt/qt3d/images/ico_note_attention.png
/usr/share/doc/qt/qt3d/images/ico_out.png
/usr/share/doc/qt/qt3d/images/logo.png
/usr/share/doc/qt/qt3d/images/multiviewport-1.png
/usr/share/doc/qt/qt3d/images/multiviewport-2.png
/usr/share/doc/qt/qt3d/images/multiviewport-qml-example.jpg
/usr/share/doc/qt/qt3d/images/multiviewport.png
/usr/share/doc/qt/qt3d/images/pbr-materials.png
/usr/share/doc/qt/qt3d/images/planets-qml-example.jpg
/usr/share/doc/qt/qt3d/images/qt3d-wireframe-rendering.png
/usr/share/doc/qt/qt3d/images/scene2d.png
/usr/share/doc/qt/qt3d/images/scene3d.png
/usr/share/doc/qt/qt3d/images/shadowmapping-depth.png
/usr/share/doc/qt/qt3d/images/shadowmapping-qt3d.png
/usr/share/doc/qt/qt3d/images/simple-cpp.png
/usr/share/doc/qt/qt3d/images/simple-custom-material.jpg
/usr/share/doc/qt/qt3d/images/simple-framegraph.png
/usr/share/doc/qt/qt3d/images/simple-qml.png
/usr/share/doc/qt/qt3d/images/wave.png
/usr/share/doc/qt/qt3d/images/widgets-scene3d.png
/usr/share/doc/qt/qt3d/style/offline-simple.css
/usr/share/doc/qt/qt3d/style/offline.css
/usr/share/doc/qt/qtandroidextras/examples-manifest.xml
/usr/share/doc/qt/qtandroidextras/examples-qtandroidextras.html
/usr/share/doc/qt/qtandroidextras/qandroidactivityresultreceiver-members.html
/usr/share/doc/qt/qtandroidextras/qandroidactivityresultreceiver.html
/usr/share/doc/qt/qtandroidextras/qandroidbinder-members.html
/usr/share/doc/qt/qtandroidextras/qandroidbinder.html
/usr/share/doc/qt/qtandroidextras/qandroidintent-members.html
/usr/share/doc/qt/qtandroidextras/qandroidintent.html
/usr/share/doc/qt/qtandroidextras/qandroidjnienvironment-members.html
/usr/share/doc/qt/qtandroidextras/qandroidjnienvironment.html
/usr/share/doc/qt/qtandroidextras/qandroidjniexceptioncleaner-members.html
/usr/share/doc/qt/qtandroidextras/qandroidjniexceptioncleaner.html
/usr/share/doc/qt/qtandroidextras/qandroidjniobject-members.html
/usr/share/doc/qt/qtandroidextras/qandroidjniobject.html
/usr/share/doc/qt/qtandroidextras/qandroidparcel-members.html
/usr/share/doc/qt/qtandroidextras/qandroidparcel.html
/usr/share/doc/qt/qtandroidextras/qandroidservice-members.html
/usr/share/doc/qt/qtandroidextras/qandroidservice.html
/usr/share/doc/qt/qtandroidextras/qandroidserviceconnection-members.html
/usr/share/doc/qt/qtandroidextras/qandroidserviceconnection.html
/usr/share/doc/qt/qtandroidextras/qtandroid.html
/usr/share/doc/qt/qtandroidextras/qtandroidextras-index.html
/usr/share/doc/qt/qtandroidextras/qtandroidextras-module.html
/usr/share/doc/qt/qtandroidextras/qtandroidextras-notification-example.html
/usr/share/doc/qt/qtandroidextras/qtandroidextras.index
/usr/share/doc/qt/qtandroidextras/qtandroidextras.qhp
/usr/share/doc/qt/qtandroidextras/qtandroidextras.qhp.sha1
/usr/share/doc/qt/qtandroidextras/images/arrow_bc.png
/usr/share/doc/qt/qtandroidextras/images/bgrContent.png
/usr/share/doc/qt/qtandroidextras/images/btn_next.png
/usr/share/doc/qt/qtandroidextras/images/btn_prev.png
/usr/share/doc/qt/qtandroidextras/images/bullet_dn.png
/usr/share/doc/qt/qtandroidextras/images/bullet_sq.png
/usr/share/doc/qt/qtandroidextras/images/home.png
/usr/share/doc/qt/qtandroidextras/images/ico_note.png
/usr/share/doc/qt/qtandroidextras/images/ico_note_attention.png
/usr/share/doc/qt/qtandroidextras/images/ico_out.png
/usr/share/doc/qt/qtandroidextras/images/logo.png
/usr/share/doc/qt/qtandroidextras/images/notification.png
/usr/share/doc/qt/qtandroidextras/style/offline-simple.css
/usr/share/doc/qt/qtandroidextras/style/offline.css
/usr/share/doc/qt/qtassistant/assistant-custom-help-viewer.html
/usr/share/doc/qt/qtassistant/assistant-details.html
/usr/share/doc/qt/qtassistant/assistant-quick-guide.html
/usr/share/doc/qt/qtassistant/examples-manifest.xml
/usr/share/doc/qt/qtassistant/examples-qtassistant.html
/usr/share/doc/qt/qtassistant/qtassistant-index.html
/usr/share/doc/qt/qtassistant/qtassistant-remotecontrol-example.html
/usr/share/doc/qt/qtassistant/qtassistant-simpletextviewer-example.html
/usr/share/doc/qt/qtassistant/qtassistant.index
/usr/share/doc/qt/qtassistant/qtassistant.qhp
/usr/share/doc/qt/qtassistant/qtassistant.qhp.sha1
/usr/share/doc/qt/qtassistant/images/arrow_bc.png
/usr/share/doc/qt/qtassistant/images/assistant-assistant.png
/usr/share/doc/qt/qtassistant/images/assistant-bookmarks.png
/usr/share/doc/qt/qtassistant/images/assistant-dockwidgets.png
/usr/share/doc/qt/qtassistant/images/assistant-examples.png
/usr/share/doc/qt/qtassistant/images/assistant-index.png
/usr/share/doc/qt/qtassistant/images/assistant-preferences-documentation.png
/usr/share/doc/qt/qtassistant/images/assistant-preferences-filters.png
/usr/share/doc/qt/qtassistant/images/assistant-preferences-fonts.png
/usr/share/doc/qt/qtassistant/images/assistant-preferences-options.png
/usr/share/doc/qt/qtassistant/images/assistant-search.png
/usr/share/doc/qt/qtassistant/images/bgrContent.png
/usr/share/doc/qt/qtassistant/images/btn_next.png
/usr/share/doc/qt/qtassistant/images/btn_prev.png
/usr/share/doc/qt/qtassistant/images/bullet_dn.png
/usr/share/doc/qt/qtassistant/images/bullet_sq.png
/usr/share/doc/qt/qtassistant/images/home.png
/usr/share/doc/qt/qtassistant/images/ico_note.png
/usr/share/doc/qt/qtassistant/images/ico_note_attention.png
/usr/share/doc/qt/qtassistant/images/ico_out.png
/usr/share/doc/qt/qtassistant/images/logo.png
/usr/share/doc/qt/qtassistant/images/simpletextviewer-example.png
/usr/share/doc/qt/qtassistant/images/simpletextviewer-findfiledialog.png
/usr/share/doc/qt/qtassistant/images/simpletextviewer-mainwindow.png
/usr/share/doc/qt/qtassistant/style/offline-simple.css
/usr/share/doc/qt/qtassistant/style/offline.css
/usr/share/doc/qt/qtbluetooth/bluetooth-examples.html
/usr/share/doc/qt/qtbluetooth/examples-manifest.xml
/usr/share/doc/qt/qtbluetooth/qbluetooth.html
/usr/share/doc/qt/qtbluetooth/qbluetoothaddress-members.html
/usr/share/doc/qt/qtbluetooth/qbluetoothaddress.html
/usr/share/doc/qt/qtbluetooth/qbluetoothdevicediscoveryagent-members.html
/usr/share/doc/qt/qtbluetooth/qbluetoothdevicediscoveryagent.html
/usr/share/doc/qt/qtbluetooth/qbluetoothdeviceinfo-members.html
/usr/share/doc/qt/qtbluetooth/qbluetoothdeviceinfo-obsolete.html
/usr/share/doc/qt/qtbluetooth/qbluetoothdeviceinfo.html
/usr/share/doc/qt/qtbluetooth/qbluetoothhostinfo-members.html
/usr/share/doc/qt/qtbluetooth/qbluetoothhostinfo.html
/usr/share/doc/qt/qtbluetooth/qbluetoothlocaldevice-members.html
/usr/share/doc/qt/qtbluetooth/qbluetoothlocaldevice.html
/usr/share/doc/qt/qtbluetooth/qbluetoothserver-members.html
/usr/share/doc/qt/qtbluetooth/qbluetoothserver.html
/usr/share/doc/qt/qtbluetooth/qbluetoothservicediscoveryagent-members.html
/usr/share/doc/qt/qtbluetooth/qbluetoothservicediscoveryagent.html
/usr/share/doc/qt/qtbluetooth/qbluetoothserviceinfo-alternative-members.html
/usr/share/doc/qt/qtbluetooth/qbluetoothserviceinfo-alternative.html
/usr/share/doc/qt/qtbluetooth/qbluetoothserviceinfo-members.html
/usr/share/doc/qt/qtbluetooth/qbluetoothserviceinfo-sequence-members.html
/usr/share/doc/qt/qtbluetooth/qbluetoothserviceinfo-sequence.html
/usr/share/doc/qt/qtbluetooth/qbluetoothserviceinfo.html
/usr/share/doc/qt/qtbluetooth/qbluetoothsocket-members.html
/usr/share/doc/qt/qtbluetooth/qbluetoothsocket.html
/usr/share/doc/qt/qtbluetooth/qbluetoothtransfermanager-members.html
/usr/share/doc/qt/qtbluetooth/qbluetoothtransfermanager.html
/usr/share/doc/qt/qtbluetooth/qbluetoothtransferreply-members.html
/usr/share/doc/qt/qtbluetooth/qbluetoothtransferreply.html
/usr/share/doc/qt/qtbluetooth/qbluetoothtransferrequest-members.html
/usr/share/doc/qt/qtbluetooth/qbluetoothtransferrequest.html
/usr/share/doc/qt/qtbluetooth/qbluetoothuuid-members.html
/usr/share/doc/qt/qtbluetooth/qbluetoothuuid.html
/usr/share/doc/qt/qtbluetooth/qlowenergyadvertisingdata-members.html
/usr/share/doc/qt/qtbluetooth/qlowenergyadvertisingdata.html
/usr/share/doc/qt/qtbluetooth/qlowenergyadvertisingparameters-addressinfo-members.html
/usr/share/doc/qt/qtbluetooth/qlowenergyadvertisingparameters-addressinfo.html
/usr/share/doc/qt/qtbluetooth/qlowenergyadvertisingparameters-members.html
/usr/share/doc/qt/qtbluetooth/qlowenergyadvertisingparameters.html
/usr/share/doc/qt/qtbluetooth/qlowenergycharacteristic-members.html
/usr/share/doc/qt/qtbluetooth/qlowenergycharacteristic.html
/usr/share/doc/qt/qtbluetooth/qlowenergycharacteristicdata-members.html
/usr/share/doc/qt/qtbluetooth/qlowenergycharacteristicdata.html
/usr/share/doc/qt/qtbluetooth/qlowenergyconnectionparameters-members.html
/usr/share/doc/qt/qtbluetooth/qlowenergyconnectionparameters.html
/usr/share/doc/qt/qtbluetooth/qlowenergycontroller-members.html
/usr/share/doc/qt/qtbluetooth/qlowenergycontroller-obsolete.html
/usr/share/doc/qt/qtbluetooth/qlowenergycontroller.html
/usr/share/doc/qt/qtbluetooth/qlowenergydescriptor-members.html
/usr/share/doc/qt/qtbluetooth/qlowenergydescriptor.html
/usr/share/doc/qt/qtbluetooth/qlowenergydescriptordata-members.html
/usr/share/doc/qt/qtbluetooth/qlowenergydescriptordata.html
/usr/share/doc/qt/qtbluetooth/qlowenergyservice-members.html
/usr/share/doc/qt/qtbluetooth/qlowenergyservice.html
/usr/share/doc/qt/qtbluetooth/qlowenergyservicedata-members.html
/usr/share/doc/qt/qtbluetooth/qlowenergyservicedata.html
/usr/share/doc/qt/qtbluetooth/qml-qtbluetooth-bluetoothdiscoverymodel-members.html
/usr/share/doc/qt/qtbluetooth/qml-qtbluetooth-bluetoothdiscoverymodel.html
/usr/share/doc/qt/qtbluetooth/qml-qtbluetooth-bluetoothservice-members.html
/usr/share/doc/qt/qtbluetooth/qml-qtbluetooth-bluetoothservice.html
/usr/share/doc/qt/qtbluetooth/qml-qtbluetooth-bluetoothsocket-members.html
/usr/share/doc/qt/qtbluetooth/qml-qtbluetooth-bluetoothsocket.html
/usr/share/doc/qt/qtbluetooth/qtbluetooth-attribution-bluez.html
/usr/share/doc/qt/qtbluetooth/qtbluetooth-btchat-example.html
/usr/share/doc/qt/qtbluetooth/qtbluetooth-btfiletransfer-example.html
/usr/share/doc/qt/qtbluetooth/qtbluetooth-btscanner-example.html
/usr/share/doc/qt/qtbluetooth/qtbluetooth-chat-example.html
/usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-game-example.html
/usr/share/doc/qt/qtbluetooth/qtbluetooth-heartrate-server-example.html
/usr/share/doc/qt/qtbluetooth/qtbluetooth-index.html
/usr/share/doc/qt/qtbluetooth/qtbluetooth-le-overview.html
/usr/share/doc/qt/qtbluetooth/qtbluetooth-lowenergyscanner-example.html
/usr/share/doc/qt/qtbluetooth/qtbluetooth-module.html
/usr/share/doc/qt/qtbluetooth/qtbluetooth-overview.html
/usr/share/doc/qt/qtbluetooth/qtbluetooth-picturetransfer-example.html
/usr/share/doc/qt/qtbluetooth/qtbluetooth-pingpong-example.html
/usr/share/doc/qt/qtbluetooth/qtbluetooth-qmlmodule.html
/usr/share/doc/qt/qtbluetooth/qtbluetooth-scanner-example.html
/usr/share/doc/qt/qtbluetooth/qtbluetooth.index
/usr/share/doc/qt/qtbluetooth/qtbluetooth.qhp
/usr/share/doc/qt/qtbluetooth/qtbluetooth.qhp.sha1
/usr/share/doc/qt/qtbluetooth/qtbluetooth.tags
/usr/share/doc/qt/qtbluetooth/images/arrow_bc.png
/usr/share/doc/qt/qtbluetooth/images/bgrContent.png
/usr/share/doc/qt/qtbluetooth/images/btchat-example.png
/usr/share/doc/qt/qtbluetooth/images/btfiletransfer-example.png
/usr/share/doc/qt/qtbluetooth/images/btn_next.png
/usr/share/doc/qt/qtbluetooth/images/btn_prev.png
/usr/share/doc/qt/qtbluetooth/images/btscanner-example.png
/usr/share/doc/qt/qtbluetooth/images/bullet_dn.png
/usr/share/doc/qt/qtbluetooth/images/bullet_sq.png
/usr/share/doc/qt/qtbluetooth/images/chat-view.png
/usr/share/doc/qt/qtbluetooth/images/devicescan.png
/usr/share/doc/qt/qtbluetooth/images/heartgame-result.png
/usr/share/doc/qt/qtbluetooth/images/heartgame-running.png
/usr/share/doc/qt/qtbluetooth/images/heartgame-search.png
/usr/share/doc/qt/qtbluetooth/images/heartgame-start.png
/usr/share/doc/qt/qtbluetooth/images/home.png
/usr/share/doc/qt/qtbluetooth/images/ico_note.png
/usr/share/doc/qt/qtbluetooth/images/ico_note_attention.png
/usr/share/doc/qt/qtbluetooth/images/ico_out.png
/usr/share/doc/qt/qtbluetooth/images/intro.png
/usr/share/doc/qt/qtbluetooth/images/intro1.png
/usr/share/doc/qt/qtbluetooth/images/logo.png
/usr/share/doc/qt/qtbluetooth/images/lowenergyscanner-chars.png
/usr/share/doc/qt/qtbluetooth/images/lowenergyscanner-devices.png
/usr/share/doc/qt/qtbluetooth/images/lowenergyscanner-services.png
/usr/share/doc/qt/qtbluetooth/images/opp-example-1.png
/usr/share/doc/qt/qtbluetooth/images/opp-example-2.png
/usr/share/doc/qt/qtbluetooth/images/opp-example-3.png
/usr/share/doc/qt/qtbluetooth/images/peripheral-structure.png
/usr/share/doc/qt/qtbluetooth/images/servicescan.png
/usr/share/doc/qt/qtbluetooth/style/offline-simple.css
/usr/share/doc/qt/qtbluetooth/style/offline.css
/usr/share/doc/qt/qtcharts/examples-manifest.xml
/usr/share/doc/qt/qtcharts/qabstractaxis-members.html
/usr/share/doc/qt/qtcharts/qabstractaxis.html
/usr/share/doc/qt/qtcharts/qabstractbarseries-members.html
/usr/share/doc/qt/qtcharts/qabstractbarseries.html
/usr/share/doc/qt/qtcharts/qabstractseries-members.html
/usr/share/doc/qt/qtcharts/qabstractseries.html
/usr/share/doc/qt/qtcharts/qarealegendmarker-members.html
/usr/share/doc/qt/qtcharts/qarealegendmarker.html
/usr/share/doc/qt/qtcharts/qareaseries-members.html
/usr/share/doc/qt/qtcharts/qareaseries.html
/usr/share/doc/qt/qtcharts/qbarcategoryaxis-members.html
/usr/share/doc/qt/qtcharts/qbarcategoryaxis.html
/usr/share/doc/qt/qtcharts/qbarlegendmarker-members.html
/usr/share/doc/qt/qtcharts/qbarlegendmarker.html
/usr/share/doc/qt/qtcharts/qbarseries-members.html
/usr/share/doc/qt/qtcharts/qbarseries.html
/usr/share/doc/qt/qtcharts/qbarset-members.html
/usr/share/doc/qt/qtcharts/qbarset.html
/usr/share/doc/qt/qtcharts/qboxplotlegendmarker-members.html
/usr/share/doc/qt/qtcharts/qboxplotlegendmarker.html
/usr/share/doc/qt/qtcharts/qboxplotseries-members.html
/usr/share/doc/qt/qtcharts/qboxplotseries.html
/usr/share/doc/qt/qtcharts/qboxset-members.html
/usr/share/doc/qt/qtcharts/qboxset.html
/usr/share/doc/qt/qtcharts/qcandlesticklegendmarker-members.html
/usr/share/doc/qt/qtcharts/qcandlesticklegendmarker.html
/usr/share/doc/qt/qtcharts/qcandlestickmodelmapper-members.html
/usr/share/doc/qt/qtcharts/qcandlestickmodelmapper.html
/usr/share/doc/qt/qtcharts/qcandlestickseries-members.html
/usr/share/doc/qt/qtcharts/qcandlestickseries.html
/usr/share/doc/qt/qtcharts/qcandlestickset-members.html
/usr/share/doc/qt/qtcharts/qcandlestickset.html
/usr/share/doc/qt/qtcharts/qcategoryaxis-members.html
/usr/share/doc/qt/qtcharts/qcategoryaxis.html
/usr/share/doc/qt/qtcharts/qchart-members.html
/usr/share/doc/qt/qtcharts/qchart-obsolete.html
/usr/share/doc/qt/qtcharts/qchart.html
/usr/share/doc/qt/qtcharts/qchartview-members.html
/usr/share/doc/qt/qtcharts/qchartview.html
/usr/share/doc/qt/qtcharts/qdatetimeaxis-members.html
/usr/share/doc/qt/qtcharts/qdatetimeaxis.html
/usr/share/doc/qt/qtcharts/qhbarmodelmapper-members.html
/usr/share/doc/qt/qtcharts/qhbarmodelmapper.html
/usr/share/doc/qt/qtcharts/qhboxplotmodelmapper-members.html
/usr/share/doc/qt/qtcharts/qhboxplotmodelmapper.html
/usr/share/doc/qt/qtcharts/qhcandlestickmodelmapper-members.html
/usr/share/doc/qt/qtcharts/qhcandlestickmodelmapper.html
/usr/share/doc/qt/qtcharts/qhorizontalbarseries-members.html
/usr/share/doc/qt/qtcharts/qhorizontalbarseries.html
/usr/share/doc/qt/qtcharts/qhorizontalpercentbarseries-members.html
/usr/share/doc/qt/qtcharts/qhorizontalpercentbarseries.html
/usr/share/doc/qt/qtcharts/qhorizontalstackedbarseries-members.html
/usr/share/doc/qt/qtcharts/qhorizontalstackedbarseries.html
/usr/share/doc/qt/qtcharts/qhpiemodelmapper-members.html
/usr/share/doc/qt/qtcharts/qhpiemodelmapper.html
/usr/share/doc/qt/qtcharts/qhxymodelmapper-members.html
/usr/share/doc/qt/qtcharts/qhxymodelmapper.html
/usr/share/doc/qt/qtcharts/qlegend-members.html
/usr/share/doc/qt/qtcharts/qlegend.html
/usr/share/doc/qt/qtcharts/qlegendmarker-members.html
/usr/share/doc/qt/qtcharts/qlegendmarker.html
/usr/share/doc/qt/qtcharts/qlineseries-members.html
/usr/share/doc/qt/qtcharts/qlineseries.html
/usr/share/doc/qt/qtcharts/qlogvalueaxis-members.html
/usr/share/doc/qt/qtcharts/qlogvalueaxis.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-abstractaxis-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-abstractaxis.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-abstractbarseries-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-abstractbarseries.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-abstractseries-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-abstractseries.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-areaseries-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-areaseries.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-barcategoryaxis-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-barcategoryaxis.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-barseries-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-barseries.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-barset-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-barset.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-boxplotseries-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-boxplotseries.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-boxset-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-boxset.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-candlestickseries-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-candlestickseries.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-candlestickset-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-candlestickset.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-categoryaxis-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-categoryaxis.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-categoryrange-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-categoryrange.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-chartview-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-chartview.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-datetimeaxis-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-datetimeaxis.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-hbarmodelmapper-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-hbarmodelmapper.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-hboxplotmodelmapper-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-hboxplotmodelmapper.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-hcandlestickmodelmapper-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-hcandlestickmodelmapper.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-horizontalbarseries-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-horizontalbarseries.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-horizontalpercentbarseries-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-horizontalpercentbarseries.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-horizontalstackedbarseries-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-horizontalstackedbarseries.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-hpiemodelmapper-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-hpiemodelmapper.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-hxymodelmapper-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-hxymodelmapper.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-legend-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-legend.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-lineseries-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-lineseries.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-logvalueaxis-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-logvalueaxis.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-margins-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-margins.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-percentbarseries-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-percentbarseries.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-pieseries-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-pieseries.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-pieslice-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-pieslice.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-polarchartview-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-polarchartview.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-scatterseries-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-scatterseries.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-splineseries-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-splineseries.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-stackedbarseries-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-stackedbarseries.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-valueaxis-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-valueaxis.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-vbarmodelmapper-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-vbarmodelmapper.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-vboxplotmodelmapper-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-vboxplotmodelmapper.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-vcandlestickmodelmapper-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-vcandlestickmodelmapper.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-vpiemodelmapper-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-vpiemodelmapper.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-vxymodelmapper-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-vxymodelmapper.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-xypoint-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-xypoint.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-xyseries-members.html
/usr/share/doc/qt/qtcharts/qml-qtcharts-xyseries.html
/usr/share/doc/qt/qtcharts/qpercentbarseries-members.html
/usr/share/doc/qt/qtcharts/qpercentbarseries.html
/usr/share/doc/qt/qtcharts/qpielegendmarker-members.html
/usr/share/doc/qt/qtcharts/qpielegendmarker.html
/usr/share/doc/qt/qtcharts/qpieseries-members.html
/usr/share/doc/qt/qtcharts/qpieseries.html
/usr/share/doc/qt/qtcharts/qpieslice-members.html
/usr/share/doc/qt/qtcharts/qpieslice.html
/usr/share/doc/qt/qtcharts/qpolarchart-members.html
/usr/share/doc/qt/qtcharts/qpolarchart.html
/usr/share/doc/qt/qtcharts/qscatterseries-members.html
/usr/share/doc/qt/qtcharts/qscatterseries.html
/usr/share/doc/qt/qtcharts/qsplineseries-members.html
/usr/share/doc/qt/qtcharts/qsplineseries.html
/usr/share/doc/qt/qtcharts/qstackedbarseries-members.html
/usr/share/doc/qt/qtcharts/qstackedbarseries.html
/usr/share/doc/qt/qtcharts/qtcharts-areachart-example.html
/usr/share/doc/qt/qtcharts/qtcharts-audio-example.html
/usr/share/doc/qt/qtcharts/qtcharts-barchart-example.html
/usr/share/doc/qt/qtcharts/qtcharts-barmodelmapper-example.html
/usr/share/doc/qt/qtcharts/qtcharts-boxplotchart-example.html
/usr/share/doc/qt/qtcharts/qtcharts-callout-example.html
/usr/share/doc/qt/qtcharts/qtcharts-candlestickchart-example.html
/usr/share/doc/qt/qtcharts/qtcharts-chartthemes-example.html
/usr/share/doc/qt/qtcharts/qtcharts-customchart-example.html
/usr/share/doc/qt/qtcharts/qtcharts-datetimeaxis-example.html
/usr/share/doc/qt/qtcharts/qtcharts-donutbreakdown-example.html
/usr/share/doc/qt/qtcharts/qtcharts-donutchart-example.html
/usr/share/doc/qt/qtcharts/qtcharts-dynamicspline-example.html
/usr/share/doc/qt/qtcharts/qtcharts-examples.html
/usr/share/doc/qt/qtcharts/qtcharts-horizontalbarchart-example.html
/usr/share/doc/qt/qtcharts/qtcharts-horizontalpercentbarchart-example.html
/usr/share/doc/qt/qtcharts/qtcharts-horizontalstackedbarchart-example.html
/usr/share/doc/qt/qtcharts/qtcharts-index.html
/usr/share/doc/qt/qtcharts/qtcharts-legend-example.html
/usr/share/doc/qt/qtcharts/qtcharts-legendmarkers-example.html
/usr/share/doc/qt/qtcharts/qtcharts-lineandbar-example.html
/usr/share/doc/qt/qtcharts/qtcharts-linechart-example.html
/usr/share/doc/qt/qtcharts/qtcharts-logvalueaxis-example.html
/usr/share/doc/qt/qtcharts/qtcharts-modeldata-example.html
/usr/share/doc/qt/qtcharts/qtcharts-module.html
/usr/share/doc/qt/qtcharts/qtcharts-multiaxis-example.html
/usr/share/doc/qt/qtcharts/qtcharts-nesteddonuts-example.html
/usr/share/doc/qt/qtcharts/qtcharts-openglseries-example.html
/usr/share/doc/qt/qtcharts/qtcharts-overview.html
/usr/share/doc/qt/qtcharts/qtcharts-percentbarchart-example.html
/usr/share/doc/qt/qtcharts/qtcharts-piechart-example.html
/usr/share/doc/qt/qtcharts/qtcharts-piechartcustomization-example.html
/usr/share/doc/qt/qtcharts/qtcharts-piechartdrilldown-example.html
/usr/share/doc/qt/qtcharts/qtcharts-polarchart-example.html
/usr/share/doc/qt/qtcharts/qtcharts-qmlaxes-example.html
/usr/share/doc/qt/qtcharts/qtcharts-qmlchart-example.html
/usr/share/doc/qt/qtcharts/qtcharts-qmlcustomizations-example.html
/usr/share/doc/qt/qtcharts/qtcharts-qmlcustomlegend-example.html
/usr/share/doc/qt/qtcharts/qtcharts-qmlf1legends-example.html
/usr/share/doc/qt/qtcharts/qtcharts-qmlmodule.html
/usr/share/doc/qt/qtcharts/qtcharts-qmloscilloscope-example.html
/usr/share/doc/qt/qtcharts/qtcharts-qmlpolarchart-example.html
/usr/share/doc/qt/qtcharts/qtcharts-qmlweather-example.html
/usr/share/doc/qt/qtcharts/qtcharts-scatterchart-example.html
/usr/share/doc/qt/qtcharts/qtcharts-scatterinteractions-example.html
/usr/share/doc/qt/qtcharts/qtcharts-splinechart-example.html
/usr/share/doc/qt/qtcharts/qtcharts-stackedbarchart-example.html
/usr/share/doc/qt/qtcharts/qtcharts-stackedbarchartdrilldown-example.html
/usr/share/doc/qt/qtcharts/qtcharts-temperaturerecords-example.html
/usr/share/doc/qt/qtcharts/qtcharts-zoomlinechart-example.html
/usr/share/doc/qt/qtcharts/qtcharts.index
/usr/share/doc/qt/qtcharts/qtcharts.qhp
/usr/share/doc/qt/qtcharts/qtcharts.qhp.sha1
/usr/share/doc/qt/qtcharts/qvalueaxis-members.html
/usr/share/doc/qt/qtcharts/qvalueaxis.html
/usr/share/doc/qt/qtcharts/qvbarmodelmapper-members.html
/usr/share/doc/qt/qtcharts/qvbarmodelmapper.html
/usr/share/doc/qt/qtcharts/qvboxplotmodelmapper-members.html
/usr/share/doc/qt/qtcharts/qvboxplotmodelmapper.html
/usr/share/doc/qt/qtcharts/qvcandlestickmodelmapper-members.html
/usr/share/doc/qt/qtcharts/qvcandlestickmodelmapper.html
/usr/share/doc/qt/qtcharts/qvpiemodelmapper-members.html
/usr/share/doc/qt/qtcharts/qvpiemodelmapper.html
/usr/share/doc/qt/qtcharts/qvxymodelmapper-members.html
/usr/share/doc/qt/qtcharts/qvxymodelmapper.html
/usr/share/doc/qt/qtcharts/qxylegendmarker-members.html
/usr/share/doc/qt/qtcharts/qxylegendmarker.html
/usr/share/doc/qt/qtcharts/qxyseries-members.html
/usr/share/doc/qt/qtcharts/qxyseries.html
/usr/share/doc/qt/qtcharts/images/api_category_axis.png
/usr/share/doc/qt/qtcharts/images/api_datatime_axis.png
/usr/share/doc/qt/qtcharts/images/arrow_bc.png
/usr/share/doc/qt/qtcharts/images/bgrContent.png
/usr/share/doc/qt/qtcharts/images/btn_next.png
/usr/share/doc/qt/qtcharts/images/btn_prev.png
/usr/share/doc/qt/qtcharts/images/bullet_dn.png
/usr/share/doc/qt/qtcharts/images/bullet_sq.png
/usr/share/doc/qt/qtcharts/images/examples_areachart.png
/usr/share/doc/qt/qtcharts/images/examples_audio.png
/usr/share/doc/qt/qtcharts/images/examples_barchart.png
/usr/share/doc/qt/qtcharts/images/examples_barmodelmapper.png
/usr/share/doc/qt/qtcharts/images/examples_boxplotchart.png
/usr/share/doc/qt/qtcharts/images/examples_callout.png
/usr/share/doc/qt/qtcharts/images/examples_candlestickchart.png
/usr/share/doc/qt/qtcharts/images/examples_chartthemes_blue_cerulean.png
/usr/share/doc/qt/qtcharts/images/examples_chartthemes_brown_sand.png
/usr/share/doc/qt/qtcharts/images/examples_chartthemes_light.png
/usr/share/doc/qt/qtcharts/images/examples_customchart.png
/usr/share/doc/qt/qtcharts/images/examples_datetimeaxis.png
/usr/share/doc/qt/qtcharts/images/examples_donutbreakdown.png
/usr/share/doc/qt/qtcharts/images/examples_donutchart.png
/usr/share/doc/qt/qtcharts/images/examples_dynamicspline1.png
/usr/share/doc/qt/qtcharts/images/examples_dynamicspline2.png
/usr/share/doc/qt/qtcharts/images/examples_horizontalbarchart.png
/usr/share/doc/qt/qtcharts/images/examples_horizontalpercentbarchart.png
/usr/share/doc/qt/qtcharts/images/examples_horizontalstackedbarchart.png
/usr/share/doc/qt/qtcharts/images/examples_legend_detach.png
/usr/share/doc/qt/qtcharts/images/examples_legend_detach2.png
/usr/share/doc/qt/qtcharts/images/examples_legendmarkers.png
/usr/share/doc/qt/qtcharts/images/examples_lineandbar.png
/usr/share/doc/qt/qtcharts/images/examples_linechart.png
/usr/share/doc/qt/qtcharts/images/examples_logvalueaxis.png
/usr/share/doc/qt/qtcharts/images/examples_modeldata.png
/usr/share/doc/qt/qtcharts/images/examples_multiaxis.png
/usr/share/doc/qt/qtcharts/images/examples_nesteddonuts.png
/usr/share/doc/qt/qtcharts/images/examples_openglseries.png
/usr/share/doc/qt/qtcharts/images/examples_percentbarchart.png
/usr/share/doc/qt/qtcharts/images/examples_percentbarchart_legend.png
/usr/share/doc/qt/qtcharts/images/examples_piechart.png
/usr/share/doc/qt/qtcharts/images/examples_piechartdrill1.png
/usr/share/doc/qt/qtcharts/images/examples_piechartdrill2.png
/usr/share/doc/qt/qtcharts/images/examples_polarchart.png
/usr/share/doc/qt/qtcharts/images/examples_qmlaxes1.png
/usr/share/doc/qt/qtcharts/images/examples_qmlaxes2.png
/usr/share/doc/qt/qtcharts/images/examples_qmlaxes3.png
/usr/share/doc/qt/qtcharts/images/examples_qmlboxplot.png
/usr/share/doc/qt/qtcharts/images/examples_qmlcandlestick.png
/usr/share/doc/qt/qtcharts/images/examples_qmlchart1.png
/usr/share/doc/qt/qtcharts/images/examples_qmlchart10.png
/usr/share/doc/qt/qtcharts/images/examples_qmlchart11.png
/usr/share/doc/qt/qtcharts/images/examples_qmlchart12.png
/usr/share/doc/qt/qtcharts/images/examples_qmlchart2.png
/usr/share/doc/qt/qtcharts/images/examples_qmlchart3.png
/usr/share/doc/qt/qtcharts/images/examples_qmlchart4.png
/usr/share/doc/qt/qtcharts/images/examples_qmlchart5.png
/usr/share/doc/qt/qtcharts/images/examples_qmlchart6.png
/usr/share/doc/qt/qtcharts/images/examples_qmlchart7.png
/usr/share/doc/qt/qtcharts/images/examples_qmlchart8.png
/usr/share/doc/qt/qtcharts/images/examples_qmlchart9.png
/usr/share/doc/qt/qtcharts/images/examples_qmlcustomizations.png
/usr/share/doc/qt/qtcharts/images/examples_qmlcustomlegend1.png
/usr/share/doc/qt/qtcharts/images/examples_qmlcustomlegend2.png
/usr/share/doc/qt/qtcharts/images/examples_qmlcustomlegend3.png
/usr/share/doc/qt/qtcharts/images/examples_qmlf1legends.png
/usr/share/doc/qt/qtcharts/images/examples_qmloscilloscope.png
/usr/share/doc/qt/qtcharts/images/examples_qmlpiechart.png
/usr/share/doc/qt/qtcharts/images/examples_qmlpolarchart1.png
/usr/share/doc/qt/qtcharts/images/examples_qmlpolarchart2.png
/usr/share/doc/qt/qtcharts/images/examples_qmlpolarchart3.png
/usr/share/doc/qt/qtcharts/images/examples_qmlweather.png
/usr/share/doc/qt/qtcharts/images/examples_scatterchart.png
/usr/share/doc/qt/qtcharts/images/examples_scatterinteractions.png
/usr/share/doc/qt/qtcharts/images/examples_splinechart.png
/usr/share/doc/qt/qtcharts/images/examples_stackedbarchart.png
/usr/share/doc/qt/qtcharts/images/examples_stackedbarchartdrilldown1.png
/usr/share/doc/qt/qtcharts/images/examples_stackedbarchartdrilldown2.png
/usr/share/doc/qt/qtcharts/images/examples_temperaturerecords.png
/usr/share/doc/qt/qtcharts/images/examples_zoomlinechart1.png
/usr/share/doc/qt/qtcharts/images/examples_zoomlinechart2.png
/usr/share/doc/qt/qtcharts/images/home.png
/usr/share/doc/qt/qtcharts/images/ico_note.png
/usr/share/doc/qt/qtcharts/images/ico_note_attention.png
/usr/share/doc/qt/qtcharts/images/ico_out.png
/usr/share/doc/qt/qtcharts/images/logo.png
/usr/share/doc/qt/qtcharts/images/piechart_customization.png
/usr/share/doc/qt/qtcharts/style/offline-simple.css
/usr/share/doc/qt/qtcharts/style/offline.css
/usr/share/doc/qt/qtconcurrent/examples-manifest.xml
/usr/share/doc/qt/qtconcurrent/qtconcurrent-imagescaling-example.html
/usr/share/doc/qt/qtconcurrent/qtconcurrent-index.html
/usr/share/doc/qt/qtconcurrent/qtconcurrent-map-example.html
/usr/share/doc/qt/qtconcurrent/qtconcurrent-module.html
/usr/share/doc/qt/qtconcurrent/qtconcurrent-obsolete.html
/usr/share/doc/qt/qtconcurrent/qtconcurrent-progressdialog-example.html
/usr/share/doc/qt/qtconcurrent/qtconcurrent-runfunction-example.html
/usr/share/doc/qt/qtconcurrent/qtconcurrent-wordcount-example.html
/usr/share/doc/qt/qtconcurrent/qtconcurrent.html
/usr/share/doc/qt/qtconcurrent/qtconcurrent.index
/usr/share/doc/qt/qtconcurrent/qtconcurrent.qhp
/usr/share/doc/qt/qtconcurrent/qtconcurrent.qhp.sha1
/usr/share/doc/qt/qtconcurrent/qtconcurrent.tags
/usr/share/doc/qt/qtconcurrent/qtconcurrentfilter.html
/usr/share/doc/qt/qtconcurrent/qtconcurrentmap.html
/usr/share/doc/qt/qtconcurrent/qtconcurrentrun.html
/usr/share/doc/qt/qtconcurrent/images/arrow_bc.png
/usr/share/doc/qt/qtconcurrent/images/bgrContent.png
/usr/share/doc/qt/qtconcurrent/images/btn_next.png
/usr/share/doc/qt/qtconcurrent/images/btn_prev.png
/usr/share/doc/qt/qtconcurrent/images/bullet_dn.png
/usr/share/doc/qt/qtconcurrent/images/bullet_sq.png
/usr/share/doc/qt/qtconcurrent/images/home.png
/usr/share/doc/qt/qtconcurrent/images/ico_note.png
/usr/share/doc/qt/qtconcurrent/images/ico_note_attention.png
/usr/share/doc/qt/qtconcurrent/images/ico_out.png
/usr/share/doc/qt/qtconcurrent/images/imagescaling_example.png
/usr/share/doc/qt/qtconcurrent/images/logo.png
/usr/share/doc/qt/qtconcurrent/images/qtconcurrent-progressdialog.png
/usr/share/doc/qt/qtconcurrent/style/offline-simple.css
/usr/share/doc/qt/qtconcurrent/style/offline.css
/usr/share/doc/qt/qtcore/animation-overview.html
/usr/share/doc/qt/qtcore/animation.html
/usr/share/doc/qt/qtcore/codec-big5.html
/usr/share/doc/qt/qtcore/codec-big5hkscs.html
/usr/share/doc/qt/qtcore/codec-eucjp.html
/usr/share/doc/qt/qtcore/codec-euckr.html
/usr/share/doc/qt/qtcore/codec-gbk.html
/usr/share/doc/qt/qtcore/codec-sjis.html
/usr/share/doc/qt/qtcore/codec-tscii.html
/usr/share/doc/qt/qtcore/codecs-jis.html
/usr/share/doc/qt/qtcore/containers.html
/usr/share/doc/qt/qtcore/custom-types.html
/usr/share/doc/qt/qtcore/datastreamformat.html
/usr/share/doc/qt/qtcore/events.html
/usr/share/doc/qt/qtcore/eventsandfilters.html
/usr/share/doc/qt/qtcore/examples-manifest.xml
/usr/share/doc/qt/qtcore/implicit-sharing.html
/usr/share/doc/qt/qtcore/io-functions.html
/usr/share/doc/qt/qtcore/io.html
/usr/share/doc/qt/qtcore/json.html
/usr/share/doc/qt/qtcore/metaobjects.html
/usr/share/doc/qt/qtcore/object.html
/usr/share/doc/qt/qtcore/objecttrees.html
/usr/share/doc/qt/qtcore/plugins.html
/usr/share/doc/qt/qtcore/properties.html
/usr/share/doc/qt/qtcore/qabstractanimation-members.html
/usr/share/doc/qt/qtcore/qabstractanimation.html
/usr/share/doc/qt/qtcore/qabstracteventdispatcher-members.html
/usr/share/doc/qt/qtcore/qabstracteventdispatcher-obsolete.html
/usr/share/doc/qt/qtcore/qabstracteventdispatcher-timerinfo-members.html
/usr/share/doc/qt/qtcore/qabstracteventdispatcher-timerinfo.html
/usr/share/doc/qt/qtcore/qabstracteventdispatcher.html
/usr/share/doc/qt/qtcore/qabstractitemmodel-members.html
/usr/share/doc/qt/qtcore/qabstractitemmodel-obsolete.html
/usr/share/doc/qt/qtcore/qabstractitemmodel.html
/usr/share/doc/qt/qtcore/qabstractlistmodel-members.html
/usr/share/doc/qt/qtcore/qabstractlistmodel.html
/usr/share/doc/qt/qtcore/qabstractnativeeventfilter-members.html
/usr/share/doc/qt/qtcore/qabstractnativeeventfilter.html
/usr/share/doc/qt/qtcore/qabstractproxymodel-members.html
/usr/share/doc/qt/qtcore/qabstractproxymodel.html
/usr/share/doc/qt/qtcore/qabstractstate-members.html
/usr/share/doc/qt/qtcore/qabstractstate.html
/usr/share/doc/qt/qtcore/qabstracttablemodel-members.html
/usr/share/doc/qt/qtcore/qabstracttablemodel.html
/usr/share/doc/qt/qtcore/qabstracttransition-members.html
/usr/share/doc/qt/qtcore/qabstracttransition.html
/usr/share/doc/qt/qtcore/qanimationgroup-members.html
/usr/share/doc/qt/qtcore/qanimationgroup.html
/usr/share/doc/qt/qtcore/qassociativeiterable-const-iterator-members.html
/usr/share/doc/qt/qtcore/qassociativeiterable-const-iterator.html
/usr/share/doc/qt/qtcore/qassociativeiterable-members.html
/usr/share/doc/qt/qtcore/qassociativeiterable.html
/usr/share/doc/qt/qtcore/qatomicint-members.html
/usr/share/doc/qt/qtcore/qatomicint.html
/usr/share/doc/qt/qtcore/qatomicinteger-members.html
/usr/share/doc/qt/qtcore/qatomicinteger.html
/usr/share/doc/qt/qtcore/qatomicpointer-members.html
/usr/share/doc/qt/qtcore/qatomicpointer.html
/usr/share/doc/qt/qtcore/qbasictimer-members.html
/usr/share/doc/qt/qtcore/qbasictimer.html
/usr/share/doc/qt/qtcore/qbeinteger-members.html
/usr/share/doc/qt/qtcore/qbeinteger.html
/usr/share/doc/qt/qtcore/qbitarray-members.html
/usr/share/doc/qt/qtcore/qbitarray.html
/usr/share/doc/qt/qtcore/qbuffer-members.html
/usr/share/doc/qt/qtcore/qbuffer.html
/usr/share/doc/qt/qtcore/qbytearray-members.html
/usr/share/doc/qt/qtcore/qbytearray.html
/usr/share/doc/qt/qtcore/qbytearraylist-members.html
/usr/share/doc/qt/qtcore/qbytearraylist.html
/usr/share/doc/qt/qtcore/qbytearraymatcher-members.html
/usr/share/doc/qt/qtcore/qbytearraymatcher.html
/usr/share/doc/qt/qtcore/qcache-members.html
/usr/share/doc/qt/qtcore/qcache.html
/usr/share/doc/qt/qtcore/qcborarray-constiterator-members.html
/usr/share/doc/qt/qtcore/qcborarray-constiterator.html
/usr/share/doc/qt/qtcore/qcborarray-iterator-members.html
/usr/share/doc/qt/qtcore/qcborarray-iterator.html
/usr/share/doc/qt/qtcore/qcborarray-members.html
/usr/share/doc/qt/qtcore/qcborarray.html
/usr/share/doc/qt/qtcore/qcborerror-members.html
/usr/share/doc/qt/qtcore/qcborerror.html
/usr/share/doc/qt/qtcore/qcbormap-constiterator-members.html
/usr/share/doc/qt/qtcore/qcbormap-constiterator.html
/usr/share/doc/qt/qtcore/qcbormap-iterator-members.html
/usr/share/doc/qt/qtcore/qcbormap-iterator.html
/usr/share/doc/qt/qtcore/qcbormap-members.html
/usr/share/doc/qt/qtcore/qcbormap.html
/usr/share/doc/qt/qtcore/qcborparsererror-members.html
/usr/share/doc/qt/qtcore/qcborparsererror.html
/usr/share/doc/qt/qtcore/qcborstreamreader-members.html
/usr/share/doc/qt/qtcore/qcborstreamreader-stringresult-members.html
/usr/share/doc/qt/qtcore/qcborstreamreader-stringresult.html
/usr/share/doc/qt/qtcore/qcborstreamreader.html
/usr/share/doc/qt/qtcore/qcborstreamwriter-members.html
/usr/share/doc/qt/qtcore/qcborstreamwriter.html
/usr/share/doc/qt/qtcore/qcborvalue-members.html
/usr/share/doc/qt/qtcore/qcborvalue.html
/usr/share/doc/qt/qtcore/qchar-members.html
/usr/share/doc/qt/qtcore/qchar-obsolete.html
/usr/share/doc/qt/qtcore/qchar.html
/usr/share/doc/qt/qtcore/qchildevent-members.html
/usr/share/doc/qt/qtcore/qchildevent.html
/usr/share/doc/qt/qtcore/qcollator-members.html
/usr/share/doc/qt/qtcore/qcollator.html
/usr/share/doc/qt/qtcore/qcollatorsortkey-members.html
/usr/share/doc/qt/qtcore/qcollatorsortkey.html
/usr/share/doc/qt/qtcore/qcommandlineoption-members.html
/usr/share/doc/qt/qtcore/qcommandlineoption-obsolete.html
/usr/share/doc/qt/qtcore/qcommandlineoption.html
/usr/share/doc/qt/qtcore/qcommandlineparser-members.html
/usr/share/doc/qt/qtcore/qcommandlineparser.html
/usr/share/doc/qt/qtcore/qconcatenatetablesproxymodel-members.html
/usr/share/doc/qt/qtcore/qconcatenatetablesproxymodel.html
/usr/share/doc/qt/qtcore/qcontiguouscache-members.html
/usr/share/doc/qt/qtcore/qcontiguouscache.html
/usr/share/doc/qt/qtcore/qcoreapplication-members.html
/usr/share/doc/qt/qtcore/qcoreapplication-obsolete.html
/usr/share/doc/qt/qtcore/qcoreapplication.html
/usr/share/doc/qt/qtcore/qcryptographichash-members.html
/usr/share/doc/qt/qtcore/qcryptographichash.html
/usr/share/doc/qt/qtcore/qdatastream-members.html
/usr/share/doc/qt/qtcore/qdatastream-obsolete.html
/usr/share/doc/qt/qtcore/qdatastream.html
/usr/share/doc/qt/qtcore/qdate-members.html
/usr/share/doc/qt/qtcore/qdate-obsolete.html
/usr/share/doc/qt/qtcore/qdate.html
/usr/share/doc/qt/qtcore/qdatetime-members.html
/usr/share/doc/qt/qtcore/qdatetime-obsolete.html
/usr/share/doc/qt/qtcore/qdatetime.html
/usr/share/doc/qt/qtcore/qdeadlinetimer-members.html
/usr/share/doc/qt/qtcore/qdeadlinetimer.html
/usr/share/doc/qt/qtcore/qdebug-members.html
/usr/share/doc/qt/qtcore/qdebug.html
/usr/share/doc/qt/qtcore/qdebugstatesaver-members.html
/usr/share/doc/qt/qtcore/qdebugstatesaver.html
/usr/share/doc/qt/qtcore/qdir-members.html
/usr/share/doc/qt/qtcore/qdir-obsolete.html
/usr/share/doc/qt/qtcore/qdir.html
/usr/share/doc/qt/qtcore/qdiriterator-members.html
/usr/share/doc/qt/qtcore/qdiriterator.html
/usr/share/doc/qt/qtcore/qdynamicpropertychangeevent-members.html
/usr/share/doc/qt/qtcore/qdynamicpropertychangeevent.html
/usr/share/doc/qt/qtcore/qeasingcurve-members.html
/usr/share/doc/qt/qtcore/qeasingcurve-obsolete.html
/usr/share/doc/qt/qtcore/qeasingcurve.html
/usr/share/doc/qt/qtcore/qelapsedtimer-members.html
/usr/share/doc/qt/qtcore/qelapsedtimer.html
/usr/share/doc/qt/qtcore/qenablesharedfromthis-members.html
/usr/share/doc/qt/qtcore/qenablesharedfromthis.html
/usr/share/doc/qt/qtcore/qevent-members.html
/usr/share/doc/qt/qtcore/qevent.html
/usr/share/doc/qt/qtcore/qeventloop-members.html
/usr/share/doc/qt/qtcore/qeventloop.html
/usr/share/doc/qt/qtcore/qeventlooplocker-members.html
/usr/share/doc/qt/qtcore/qeventlooplocker.html
/usr/share/doc/qt/qtcore/qeventtransition-members.html
/usr/share/doc/qt/qtcore/qeventtransition.html
/usr/share/doc/qt/qtcore/qexception-members.html
/usr/share/doc/qt/qtcore/qexception.html
/usr/share/doc/qt/qtcore/qexplicitlyshareddatapointer-members.html
/usr/share/doc/qt/qtcore/qexplicitlyshareddatapointer.html
/usr/share/doc/qt/qtcore/qfile-members.html
/usr/share/doc/qt/qtcore/qfile-obsolete.html
/usr/share/doc/qt/qtcore/qfile.html
/usr/share/doc/qt/qtcore/qfiledevice-members.html
/usr/share/doc/qt/qtcore/qfiledevice.html
/usr/share/doc/qt/qtcore/qfileinfo-members.html
/usr/share/doc/qt/qtcore/qfileinfo-obsolete.html
/usr/share/doc/qt/qtcore/qfileinfo.html
/usr/share/doc/qt/qtcore/qfileselector-members.html
/usr/share/doc/qt/qtcore/qfileselector.html
/usr/share/doc/qt/qtcore/qfilesystemwatcher-members.html
/usr/share/doc/qt/qtcore/qfilesystemwatcher.html
/usr/share/doc/qt/qtcore/qfinalstate-members.html
/usr/share/doc/qt/qtcore/qfinalstate.html
/usr/share/doc/qt/qtcore/qflag-members.html
/usr/share/doc/qt/qtcore/qflag.html
/usr/share/doc/qt/qtcore/qflags-members.html
/usr/share/doc/qt/qtcore/qflags.html
/usr/share/doc/qt/qtcore/qfloat16.html
/usr/share/doc/qt/qtcore/qfuture-const-iterator-members.html
/usr/share/doc/qt/qtcore/qfuture-const-iterator.html
/usr/share/doc/qt/qtcore/qfuture-members.html
/usr/share/doc/qt/qtcore/qfuture.html
/usr/share/doc/qt/qtcore/qfutureiterator-members.html
/usr/share/doc/qt/qtcore/qfutureiterator.html
/usr/share/doc/qt/qtcore/qfuturesynchronizer-members.html
/usr/share/doc/qt/qtcore/qfuturesynchronizer.html
/usr/share/doc/qt/qtcore/qfuturewatcher-members.html
/usr/share/doc/qt/qtcore/qfuturewatcher.html
/usr/share/doc/qt/qtcore/qgenericargument-members.html
/usr/share/doc/qt/qtcore/qgenericargument.html
/usr/share/doc/qt/qtcore/qgenericreturnargument-members.html
/usr/share/doc/qt/qtcore/qgenericreturnargument.html
/usr/share/doc/qt/qtcore/qglobalstatic-members.html
/usr/share/doc/qt/qtcore/qglobalstatic-obsolete.html
/usr/share/doc/qt/qtcore/qglobalstatic.html
/usr/share/doc/qt/qtcore/qhash-const-iterator-members.html
/usr/share/doc/qt/qtcore/qhash-const-iterator.html
/usr/share/doc/qt/qtcore/qhash-iterator-members.html
/usr/share/doc/qt/qtcore/qhash-iterator.html
/usr/share/doc/qt/qtcore/qhash-key-iterator-members.html
/usr/share/doc/qt/qtcore/qhash-key-iterator.html
/usr/share/doc/qt/qtcore/qhash-members.html
/usr/share/doc/qt/qtcore/qhash.html
/usr/share/doc/qt/qtcore/qhashiterator-members.html
/usr/share/doc/qt/qtcore/qhashiterator.html
/usr/share/doc/qt/qtcore/qhistorystate-members.html
/usr/share/doc/qt/qtcore/qhistorystate.html
/usr/share/doc/qt/qtcore/qidentityproxymodel-members.html
/usr/share/doc/qt/qtcore/qidentityproxymodel.html
/usr/share/doc/qt/qtcore/qiodevice-members.html
/usr/share/doc/qt/qtcore/qiodevice.html
/usr/share/doc/qt/qtcore/qitemselection-members.html
/usr/share/doc/qt/qtcore/qitemselection.html
/usr/share/doc/qt/qtcore/qitemselectionmodel-members.html
/usr/share/doc/qt/qtcore/qitemselectionmodel.html
/usr/share/doc/qt/qtcore/qitemselectionrange-members.html
/usr/share/doc/qt/qtcore/qitemselectionrange-obsolete.html
/usr/share/doc/qt/qtcore/qitemselectionrange.html
/usr/share/doc/qt/qtcore/qjsonarray-const-iterator-members.html
/usr/share/doc/qt/qtcore/qjsonarray-const-iterator.html
/usr/share/doc/qt/qtcore/qjsonarray-iterator-members.html
/usr/share/doc/qt/qtcore/qjsonarray-iterator.html
/usr/share/doc/qt/qtcore/qjsonarray-members.html
/usr/share/doc/qt/qtcore/qjsonarray.html
/usr/share/doc/qt/qtcore/qjsondocument-members.html
/usr/share/doc/qt/qtcore/qjsondocument.html
/usr/share/doc/qt/qtcore/qjsonobject-const-iterator-members.html
/usr/share/doc/qt/qtcore/qjsonobject-const-iterator.html
/usr/share/doc/qt/qtcore/qjsonobject-iterator-members.html
/usr/share/doc/qt/qtcore/qjsonobject-iterator.html
/usr/share/doc/qt/qtcore/qjsonobject-members.html
/usr/share/doc/qt/qtcore/qjsonobject.html
/usr/share/doc/qt/qtcore/qjsonparseerror-members.html
/usr/share/doc/qt/qtcore/qjsonparseerror.html
/usr/share/doc/qt/qtcore/qjsonvalue-members.html
/usr/share/doc/qt/qtcore/qjsonvalue.html
/usr/share/doc/qt/qtcore/qkeyvalueiterator-members.html
/usr/share/doc/qt/qtcore/qkeyvalueiterator.html
/usr/share/doc/qt/qtcore/qlatin1char-members.html
/usr/share/doc/qt/qtcore/qlatin1char.html
/usr/share/doc/qt/qtcore/qlatin1string-members.html
/usr/share/doc/qt/qtcore/qlatin1string.html
/usr/share/doc/qt/qtcore/qleinteger-members.html
/usr/share/doc/qt/qtcore/qleinteger.html
/usr/share/doc/qt/qtcore/qlibrary-members.html
/usr/share/doc/qt/qtcore/qlibrary.html
/usr/share/doc/qt/qtcore/qlibraryinfo-members.html
/usr/share/doc/qt/qtcore/qlibraryinfo-obsolete.html
/usr/share/doc/qt/qtcore/qlibraryinfo.html
/usr/share/doc/qt/qtcore/qline-members.html
/usr/share/doc/qt/qtcore/qline.html
/usr/share/doc/qt/qtcore/qlinef-members.html
/usr/share/doc/qt/qtcore/qlinef-obsolete.html
/usr/share/doc/qt/qtcore/qlinef.html
/usr/share/doc/qt/qtcore/qlinkedlist-const-iterator-members.html
/usr/share/doc/qt/qtcore/qlinkedlist-const-iterator.html
/usr/share/doc/qt/qtcore/qlinkedlist-iterator-members.html
/usr/share/doc/qt/qtcore/qlinkedlist-iterator.html
/usr/share/doc/qt/qtcore/qlinkedlist-members.html
/usr/share/doc/qt/qtcore/qlinkedlist.html
/usr/share/doc/qt/qtcore/qlinkedlistiterator-members.html
/usr/share/doc/qt/qtcore/qlinkedlistiterator.html
/usr/share/doc/qt/qtcore/qlist-const-iterator-members.html
/usr/share/doc/qt/qtcore/qlist-const-iterator.html
/usr/share/doc/qt/qtcore/qlist-iterator-members.html
/usr/share/doc/qt/qtcore/qlist-iterator.html
/usr/share/doc/qt/qtcore/qlist-members.html
/usr/share/doc/qt/qtcore/qlist-obsolete.html
/usr/share/doc/qt/qtcore/qlist.html
/usr/share/doc/qt/qtcore/qlistiterator-members.html
/usr/share/doc/qt/qtcore/qlistiterator.html
/usr/share/doc/qt/qtcore/qlocale-members.html
/usr/share/doc/qt/qtcore/qlocale-obsolete.html
/usr/share/doc/qt/qtcore/qlocale.html
/usr/share/doc/qt/qtcore/qlockfile-members.html
/usr/share/doc/qt/qtcore/qlockfile.html
/usr/share/doc/qt/qtcore/qloggingcategory-members.html
/usr/share/doc/qt/qtcore/qloggingcategory.html
/usr/share/doc/qt/qtcore/qmap-const-iterator-members.html
/usr/share/doc/qt/qtcore/qmap-const-iterator.html
/usr/share/doc/qt/qtcore/qmap-iterator-members.html
/usr/share/doc/qt/qtcore/qmap-iterator.html
/usr/share/doc/qt/qtcore/qmap-key-iterator-members.html
/usr/share/doc/qt/qtcore/qmap-key-iterator.html
/usr/share/doc/qt/qtcore/qmap-members.html
/usr/share/doc/qt/qtcore/qmap.html
/usr/share/doc/qt/qtcore/qmapiterator-members.html
/usr/share/doc/qt/qtcore/qmapiterator.html
/usr/share/doc/qt/qtcore/qmargins-members.html
/usr/share/doc/qt/qtcore/qmargins.html
/usr/share/doc/qt/qtcore/qmarginsf-members.html
/usr/share/doc/qt/qtcore/qmarginsf.html
/usr/share/doc/qt/qtcore/qmessageauthenticationcode-members.html
/usr/share/doc/qt/qtcore/qmessageauthenticationcode.html
/usr/share/doc/qt/qtcore/qmessagelogcontext.html
/usr/share/doc/qt/qtcore/qmessagelogger-members.html
/usr/share/doc/qt/qtcore/qmessagelogger.html
/usr/share/doc/qt/qtcore/qmetaclassinfo-members.html
/usr/share/doc/qt/qtcore/qmetaclassinfo.html
/usr/share/doc/qt/qtcore/qmetaenum-members.html
/usr/share/doc/qt/qtcore/qmetaenum.html
/usr/share/doc/qt/qtcore/qmetamethod-members.html
/usr/share/doc/qt/qtcore/qmetamethod.html
/usr/share/doc/qt/qtcore/qmetaobject-connection-members.html
/usr/share/doc/qt/qtcore/qmetaobject-connection.html
/usr/share/doc/qt/qtcore/qmetaobject-members.html
/usr/share/doc/qt/qtcore/qmetaobject.html
/usr/share/doc/qt/qtcore/qmetaproperty-members.html
/usr/share/doc/qt/qtcore/qmetaproperty-obsolete.html
/usr/share/doc/qt/qtcore/qmetaproperty.html
/usr/share/doc/qt/qtcore/qmetatype-members.html
/usr/share/doc/qt/qtcore/qmetatype-obsolete.html
/usr/share/doc/qt/qtcore/qmetatype.html
/usr/share/doc/qt/qtcore/qmimedata-members.html
/usr/share/doc/qt/qtcore/qmimedata.html
/usr/share/doc/qt/qtcore/qmimedatabase-members.html
/usr/share/doc/qt/qtcore/qmimedatabase.html
/usr/share/doc/qt/qtcore/qmimetype-members.html
/usr/share/doc/qt/qtcore/qmimetype.html
/usr/share/doc/qt/qtcore/qmodelindex-members.html
/usr/share/doc/qt/qtcore/qmodelindex-obsolete.html
/usr/share/doc/qt/qtcore/qmodelindex.html
/usr/share/doc/qt/qtcore/qmultihash-members.html
/usr/share/doc/qt/qtcore/qmultihash.html
/usr/share/doc/qt/qtcore/qmultimap-members.html
/usr/share/doc/qt/qtcore/qmultimap.html
/usr/share/doc/qt/qtcore/qmutablehashiterator-members.html
/usr/share/doc/qt/qtcore/qmutablehashiterator.html
/usr/share/doc/qt/qtcore/qmutablelinkedlistiterator-members.html
/usr/share/doc/qt/qtcore/qmutablelinkedlistiterator.html
/usr/share/doc/qt/qtcore/qmutablelistiterator-members.html
/usr/share/doc/qt/qtcore/qmutablelistiterator.html
/usr/share/doc/qt/qtcore/qmutablemapiterator-members.html
/usr/share/doc/qt/qtcore/qmutablemapiterator.html
/usr/share/doc/qt/qtcore/qmutablesetiterator-members.html
/usr/share/doc/qt/qtcore/qmutablesetiterator.html
/usr/share/doc/qt/qtcore/qmutablevectoriterator-members.html
/usr/share/doc/qt/qtcore/qmutablevectoriterator.html
/usr/share/doc/qt/qtcore/qmutex-members.html
/usr/share/doc/qt/qtcore/qmutex.html
/usr/share/doc/qt/qtcore/qmutexlocker-members.html
/usr/share/doc/qt/qtcore/qmutexlocker.html
/usr/share/doc/qt/qtcore/qobject-members.html
/usr/share/doc/qt/qtcore/qobject-obsolete.html
/usr/share/doc/qt/qtcore/qobject.html
/usr/share/doc/qt/qtcore/qobjectcleanuphandler-members.html
/usr/share/doc/qt/qtcore/qobjectcleanuphandler.html
/usr/share/doc/qt/qtcore/qoperatingsystemversion-members.html
/usr/share/doc/qt/qtcore/qoperatingsystemversion.html
/usr/share/doc/qt/qtcore/qpair-members.html
/usr/share/doc/qt/qtcore/qpair.html
/usr/share/doc/qt/qtcore/qparallelanimationgroup-members.html
/usr/share/doc/qt/qtcore/qparallelanimationgroup.html
/usr/share/doc/qt/qtcore/qpauseanimation-members.html
/usr/share/doc/qt/qtcore/qpauseanimation.html
/usr/share/doc/qt/qtcore/qpersistentmodelindex-members.html
/usr/share/doc/qt/qtcore/qpersistentmodelindex-obsolete.html
/usr/share/doc/qt/qtcore/qpersistentmodelindex.html
/usr/share/doc/qt/qtcore/qpluginloader-members.html
/usr/share/doc/qt/qtcore/qpluginloader.html
/usr/share/doc/qt/qtcore/qpoint-members.html
/usr/share/doc/qt/qtcore/qpoint.html
/usr/share/doc/qt/qtcore/qpointer-members.html
/usr/share/doc/qt/qtcore/qpointer.html
/usr/share/doc/qt/qtcore/qpointf-members.html
/usr/share/doc/qt/qtcore/qpointf.html
/usr/share/doc/qt/qtcore/qprocess-createprocessarguments.html
/usr/share/doc/qt/qtcore/qprocess-members.html
/usr/share/doc/qt/qtcore/qprocess-obsolete.html
/usr/share/doc/qt/qtcore/qprocess.html
/usr/share/doc/qt/qtcore/qprocessenvironment-members.html
/usr/share/doc/qt/qtcore/qprocessenvironment.html
/usr/share/doc/qt/qtcore/qpropertyanimation-members.html
/usr/share/doc/qt/qtcore/qpropertyanimation.html
/usr/share/doc/qt/qtcore/qqueue-members.html
/usr/share/doc/qt/qtcore/qqueue.html
/usr/share/doc/qt/qtcore/qrandomgenerator-members.html
/usr/share/doc/qt/qtcore/qrandomgenerator.html
/usr/share/doc/qt/qtcore/qrandomgenerator64-members.html
/usr/share/doc/qt/qtcore/qrandomgenerator64.html
/usr/share/doc/qt/qtcore/qreadlocker-members.html
/usr/share/doc/qt/qtcore/qreadlocker.html
/usr/share/doc/qt/qtcore/qreadwritelock-members.html
/usr/share/doc/qt/qtcore/qreadwritelock.html
/usr/share/doc/qt/qtcore/qrect-members.html
/usr/share/doc/qt/qtcore/qrect-obsolete.html
/usr/share/doc/qt/qtcore/qrect.html
/usr/share/doc/qt/qtcore/qrectf-members.html
/usr/share/doc/qt/qtcore/qrectf-obsolete.html
/usr/share/doc/qt/qtcore/qrectf.html
/usr/share/doc/qt/qtcore/qregexp-members.html
/usr/share/doc/qt/qtcore/qregexp.html
/usr/share/doc/qt/qtcore/qregularexpression-members.html
/usr/share/doc/qt/qtcore/qregularexpression.html
/usr/share/doc/qt/qtcore/qregularexpressionmatch-members.html
/usr/share/doc/qt/qtcore/qregularexpressionmatch.html
/usr/share/doc/qt/qtcore/qregularexpressionmatchiterator-members.html
/usr/share/doc/qt/qtcore/qregularexpressionmatchiterator.html
/usr/share/doc/qt/qtcore/qresource-members.html
/usr/share/doc/qt/qtcore/qresource-obsolete.html
/usr/share/doc/qt/qtcore/qresource.html
/usr/share/doc/qt/qtcore/qrunnable-members.html
/usr/share/doc/qt/qtcore/qrunnable.html
/usr/share/doc/qt/qtcore/qsavefile-members.html
/usr/share/doc/qt/qtcore/qsavefile.html
/usr/share/doc/qt/qtcore/qscopedarraypointer-members.html
/usr/share/doc/qt/qtcore/qscopedarraypointer.html
/usr/share/doc/qt/qtcore/qscopedpointer-members.html
/usr/share/doc/qt/qtcore/qscopedpointer.html
/usr/share/doc/qt/qtcore/qscopedvaluerollback-members.html
/usr/share/doc/qt/qtcore/qscopedvaluerollback.html
/usr/share/doc/qt/qtcore/qscopeguard-members.html
/usr/share/doc/qt/qtcore/qscopeguard.html
/usr/share/doc/qt/qtcore/qsemaphore-members.html
/usr/share/doc/qt/qtcore/qsemaphore.html
/usr/share/doc/qt/qtcore/qsemaphorereleaser-members.html
/usr/share/doc/qt/qtcore/qsemaphorereleaser.html
/usr/share/doc/qt/qtcore/qsequentialanimationgroup-members.html
/usr/share/doc/qt/qtcore/qsequentialanimationgroup.html
/usr/share/doc/qt/qtcore/qsequentialiterable-const-iterator-members.html
/usr/share/doc/qt/qtcore/qsequentialiterable-const-iterator.html
/usr/share/doc/qt/qtcore/qsequentialiterable-members.html
/usr/share/doc/qt/qtcore/qsequentialiterable.html
/usr/share/doc/qt/qtcore/qset-const-iterator-members.html
/usr/share/doc/qt/qtcore/qset-const-iterator.html
/usr/share/doc/qt/qtcore/qset-iterator-members.html
/usr/share/doc/qt/qtcore/qset-iterator.html
/usr/share/doc/qt/qtcore/qset-members.html
/usr/share/doc/qt/qtcore/qset.html
/usr/share/doc/qt/qtcore/qsetiterator-members.html
/usr/share/doc/qt/qtcore/qsetiterator.html
/usr/share/doc/qt/qtcore/qsettings-members.html
/usr/share/doc/qt/qtcore/qsettings-obsolete.html
/usr/share/doc/qt/qtcore/qsettings.html
/usr/share/doc/qt/qtcore/qshareddata-members.html
/usr/share/doc/qt/qtcore/qshareddata.html
/usr/share/doc/qt/qtcore/qshareddatapointer-members.html
/usr/share/doc/qt/qtcore/qshareddatapointer.html
/usr/share/doc/qt/qtcore/qsharedmemory-members.html
/usr/share/doc/qt/qtcore/qsharedmemory.html
/usr/share/doc/qt/qtcore/qsharedpointer-members.html
/usr/share/doc/qt/qtcore/qsharedpointer.html
/usr/share/doc/qt/qtcore/qsignalblocker-members.html
/usr/share/doc/qt/qtcore/qsignalblocker.html
/usr/share/doc/qt/qtcore/qsignalmapper-members.html
/usr/share/doc/qt/qtcore/qsignalmapper.html
/usr/share/doc/qt/qtcore/qsignaltransition-members.html
/usr/share/doc/qt/qtcore/qsignaltransition.html
/usr/share/doc/qt/qtcore/qsize-members.html
/usr/share/doc/qt/qtcore/qsize.html
/usr/share/doc/qt/qtcore/qsizef-members.html
/usr/share/doc/qt/qtcore/qsizef.html
/usr/share/doc/qt/qtcore/qsocketnotifier-members.html
/usr/share/doc/qt/qtcore/qsocketnotifier.html
/usr/share/doc/qt/qtcore/qsortfilterproxymodel-members.html
/usr/share/doc/qt/qtcore/qsortfilterproxymodel-obsolete.html
/usr/share/doc/qt/qtcore/qsortfilterproxymodel.html
/usr/share/doc/qt/qtcore/qstack-members.html
/usr/share/doc/qt/qtcore/qstack.html
/usr/share/doc/qt/qtcore/qstandardpaths-members.html
/usr/share/doc/qt/qtcore/qstandardpaths-obsolete.html
/usr/share/doc/qt/qtcore/qstandardpaths.html
/usr/share/doc/qt/qtcore/qstate-members.html
/usr/share/doc/qt/qtcore/qstate.html
/usr/share/doc/qt/qtcore/qstatemachine-members.html
/usr/share/doc/qt/qtcore/qstatemachine-signalevent-members.html
/usr/share/doc/qt/qtcore/qstatemachine-signalevent.html
/usr/share/doc/qt/qtcore/qstatemachine-wrappedevent-members.html
/usr/share/doc/qt/qtcore/qstatemachine-wrappedevent.html
/usr/share/doc/qt/qtcore/qstatemachine.html
/usr/share/doc/qt/qtcore/qstaticbytearraymatcher-members.html
/usr/share/doc/qt/qtcore/qstaticbytearraymatcher.html
/usr/share/doc/qt/qtcore/qstaticplugin-members.html
/usr/share/doc/qt/qtcore/qstaticplugin.html
/usr/share/doc/qt/qtcore/qstorageinfo-members.html
/usr/share/doc/qt/qtcore/qstorageinfo.html
/usr/share/doc/qt/qtcore/qstring-members.html
/usr/share/doc/qt/qtcore/qstring-obsolete.html
/usr/share/doc/qt/qtcore/qstring.html
/usr/share/doc/qt/qtcore/qstringlist-members.html
/usr/share/doc/qt/qtcore/qstringlist.html
/usr/share/doc/qt/qtcore/qstringlistmodel-members.html
/usr/share/doc/qt/qtcore/qstringlistmodel.html
/usr/share/doc/qt/qtcore/qstringmatcher-members.html
/usr/share/doc/qt/qtcore/qstringmatcher.html
/usr/share/doc/qt/qtcore/qstringref-members.html
/usr/share/doc/qt/qtcore/qstringref-obsolete.html
/usr/share/doc/qt/qtcore/qstringref.html
/usr/share/doc/qt/qtcore/qstringview-members.html
/usr/share/doc/qt/qtcore/qstringview.html
/usr/share/doc/qt/qtcore/qsysinfo-members.html
/usr/share/doc/qt/qtcore/qsysinfo-obsolete.html
/usr/share/doc/qt/qtcore/qsysinfo.html
/usr/share/doc/qt/qtcore/qsystemsemaphore-members.html
/usr/share/doc/qt/qtcore/qsystemsemaphore.html
/usr/share/doc/qt/qtcore/qt-obsolete.html
/usr/share/doc/qt/qtcore/qt.html
/usr/share/doc/qt/qtcore/qtalgorithms-obsolete.html
/usr/share/doc/qt/qtcore/qtalgorithms.html
/usr/share/doc/qt/qtcore/qtcborcommon.html
/usr/share/doc/qt/qtcore/qtcore-attribution-android-gradle-wrapper.html
/usr/share/doc/qt/qtcore/qtcore-attribution-doubleconversion.html
/usr/share/doc/qt/qtcore/qtcore-attribution-easing.html
/usr/share/doc/qt/qtcore/qtcore-attribution-forkfd.html
/usr/share/doc/qt/qtcore/qtcore-attribution-freebsd.html
/usr/share/doc/qt/qtcore/qtcore-attribution-md4.html
/usr/share/doc/qt/qtcore/qtcore-attribution-md5.html
/usr/share/doc/qt/qtcore/qtcore-attribution-pcre2-sljit.html
/usr/share/doc/qt/qtcore/qtcore-attribution-pcre2.html
/usr/share/doc/qt/qtcore/qtcore-attribution-psl.html
/usr/share/doc/qt/qtcore/qtcore-attribution-qbig5codecs.html
/usr/share/doc/qt/qtcore/qtcore-attribution-qbkcodec.html
/usr/share/doc/qt/qtcore/qtcore-attribution-qeucjpcodec.html
/usr/share/doc/qt/qtcore/qtcore-attribution-qeuckrcodec.html
/usr/share/doc/qt/qtcore/qtcore-attribution-qeventdispatcher-cf.html
/usr/share/doc/qt/qtcore/qtcore-attribution-qjiscodec.html
/usr/share/doc/qt/qtcore/qtcore-attribution-qsjiscodec.html
/usr/share/doc/qt/qtcore/qtcore-attribution-qtsciicodec.html
/usr/share/doc/qt/qtcore/qtcore-attribution-rfc6234.html
/usr/share/doc/qt/qtcore/qtcore-attribution-sha1.html
/usr/share/doc/qt/qtcore/qtcore-attribution-sha3-endian.html
/usr/share/doc/qt/qtcore/qtcore-attribution-sha3-keccak.html
/usr/share/doc/qt/qtcore/qtcore-attribution-tinycbor.html
/usr/share/doc/qt/qtcore/qtcore-attribution-unicode-character-database.html
/usr/share/doc/qt/qtcore/qtcore-attribution-unicode-cldr.html
/usr/share/doc/qt/qtcore/qtcore-attribution-zlib.html
/usr/share/doc/qt/qtcore/qtcore-cmake-qt5-add-big-resources.html
/usr/share/doc/qt/qtcore/qtcore-cmake-qt5-add-binary-resources.html
/usr/share/doc/qt/qtcore/qtcore-cmake-qt5-add-resources.html
/usr/share/doc/qt/qtcore/qtcore-cmake-qt5-generate-moc.html
/usr/share/doc/qt/qtcore/qtcore-cmake-qt5-wrap-cpp.html
/usr/share/doc/qt/qtcore/qtcore-index.html
/usr/share/doc/qt/qtcore/qtcore-ipc-localfortuneclient-example.html
/usr/share/doc/qt/qtcore/qtcore-ipc-localfortuneserver-example.html
/usr/share/doc/qt/qtcore/qtcore-ipc-sharedmemory-example.html
/usr/share/doc/qt/qtcore/qtcore-mimetypes-mimetypebrowser-example.html
/usr/share/doc/qt/qtcore/qtcore-module.html
/usr/share/doc/qt/qtcore/qtcore-serialization-savegame-example.html
/usr/share/doc/qt/qtcore/qtcore-threads-mandelbrot-example.html
/usr/share/doc/qt/qtcore/qtcore-threads-queuedcustomtype-example.html
/usr/share/doc/qt/qtcore/qtcore-threads-semaphores-example.html
/usr/share/doc/qt/qtcore/qtcore-threads-waitconditions-example.html
/usr/share/doc/qt/qtcore/qtcore-tools-contiguouscache-example.html
/usr/share/doc/qt/qtcore/qtcore-tools-customtype-example.html
/usr/share/doc/qt/qtcore/qtcore.index
/usr/share/doc/qt/qtcore/qtcore.qhp
/usr/share/doc/qt/qtcore/qtcore.qhp.sha1
/usr/share/doc/qt/qtcore/qtcore.tags
/usr/share/doc/qt/qtcore/qtemporarydir-members.html
/usr/share/doc/qt/qtcore/qtemporarydir.html
/usr/share/doc/qt/qtcore/qtemporaryfile-members.html
/usr/share/doc/qt/qtcore/qtemporaryfile-obsolete.html
/usr/share/doc/qt/qtcore/qtemporaryfile.html
/usr/share/doc/qt/qtcore/qtendian.html
/usr/share/doc/qt/qtcore/qtextboundaryfinder-members.html
/usr/share/doc/qt/qtcore/qtextboundaryfinder.html
/usr/share/doc/qt/qtcore/qtextcodec-members.html
/usr/share/doc/qt/qtcore/qtextcodec-obsolete.html
/usr/share/doc/qt/qtcore/qtextcodec.html
/usr/share/doc/qt/qtcore/qtextdecoder-members.html
/usr/share/doc/qt/qtcore/qtextdecoder.html
/usr/share/doc/qt/qtcore/qtextencoder-members.html
/usr/share/doc/qt/qtcore/qtextencoder.html
/usr/share/doc/qt/qtcore/qtextstream-members.html
/usr/share/doc/qt/qtcore/qtextstream.html
/usr/share/doc/qt/qtcore/qtglobal-obsolete.html
/usr/share/doc/qt/qtcore/qtglobal.html
/usr/share/doc/qt/qtcore/qthread-members.html
/usr/share/doc/qt/qtcore/qthread.html
/usr/share/doc/qt/qtcore/qthreadpool-members.html
/usr/share/doc/qt/qtcore/qthreadpool-obsolete.html
/usr/share/doc/qt/qtcore/qthreadpool.html
/usr/share/doc/qt/qtcore/qthreadstorage-members.html
/usr/share/doc/qt/qtcore/qthreadstorage.html
/usr/share/doc/qt/qtcore/qtime-members.html
/usr/share/doc/qt/qtcore/qtime.html
/usr/share/doc/qt/qtcore/qtimeline-members.html
/usr/share/doc/qt/qtcore/qtimeline.html
/usr/share/doc/qt/qtcore/qtimer-members.html
/usr/share/doc/qt/qtcore/qtimer.html
/usr/share/doc/qt/qtcore/qtimerevent-members.html
/usr/share/doc/qt/qtcore/qtimerevent.html
/usr/share/doc/qt/qtcore/qtimezone-members.html
/usr/share/doc/qt/qtcore/qtimezone-offsetdata.html
/usr/share/doc/qt/qtcore/qtimezone.html
/usr/share/doc/qt/qtcore/qtmath.html
/usr/share/doc/qt/qtcore/qtplugin.html
/usr/share/doc/qt/qtcore/qtranslator-members.html
/usr/share/doc/qt/qtcore/qtranslator.html
/usr/share/doc/qt/qtcore/qtransposeproxymodel-members.html
/usr/share/doc/qt/qtcore/qtransposeproxymodel.html
/usr/share/doc/qt/qtcore/qunhandledexception-members.html
/usr/share/doc/qt/qtcore/qunhandledexception.html
/usr/share/doc/qt/qtcore/qurl-members.html
/usr/share/doc/qt/qtcore/qurl-obsolete.html
/usr/share/doc/qt/qtcore/qurl.html
/usr/share/doc/qt/qtcore/qurlquery-members.html
/usr/share/doc/qt/qtcore/qurlquery.html
/usr/share/doc/qt/qtcore/quuid-members.html
/usr/share/doc/qt/qtcore/quuid.html
/usr/share/doc/qt/qtcore/qvariant-members.html
/usr/share/doc/qt/qtcore/qvariant-obsolete.html
/usr/share/doc/qt/qtcore/qvariant.html
/usr/share/doc/qt/qtcore/qvariantanimation-members.html
/usr/share/doc/qt/qtcore/qvariantanimation.html
/usr/share/doc/qt/qtcore/qvarlengtharray-members.html
/usr/share/doc/qt/qtcore/qvarlengtharray.html
/usr/share/doc/qt/qtcore/qvector-members.html
/usr/share/doc/qt/qtcore/qvector.html
/usr/share/doc/qt/qtcore/qvectoriterator-members.html
/usr/share/doc/qt/qtcore/qvectoriterator.html
/usr/share/doc/qt/qtcore/qversionnumber-members.html
/usr/share/doc/qt/qtcore/qversionnumber.html
/usr/share/doc/qt/qtcore/qwaitcondition-members.html
/usr/share/doc/qt/qtcore/qwaitcondition.html
/usr/share/doc/qt/qtcore/qweakpointer-members.html
/usr/share/doc/qt/qtcore/qweakpointer-obsolete.html
/usr/share/doc/qt/qtcore/qweakpointer.html
/usr/share/doc/qt/qtcore/qwineventnotifier-members.html
/usr/share/doc/qt/qtcore/qwineventnotifier.html
/usr/share/doc/qt/qtcore/qwritelocker-members.html
/usr/share/doc/qt/qtcore/qwritelocker.html
/usr/share/doc/qt/qtcore/qxmlstreamattribute-members.html
/usr/share/doc/qt/qtcore/qxmlstreamattribute.html
/usr/share/doc/qt/qtcore/qxmlstreamattributes-members.html
/usr/share/doc/qt/qtcore/qxmlstreamattributes.html
/usr/share/doc/qt/qtcore/qxmlstreamentitydeclaration-members.html
/usr/share/doc/qt/qtcore/qxmlstreamentitydeclaration.html
/usr/share/doc/qt/qtcore/qxmlstreamentityresolver-members.html
/usr/share/doc/qt/qtcore/qxmlstreamentityresolver.html
/usr/share/doc/qt/qtcore/qxmlstreamnamespacedeclaration-members.html
/usr/share/doc/qt/qtcore/qxmlstreamnamespacedeclaration.html
/usr/share/doc/qt/qtcore/qxmlstreamnotationdeclaration-members.html
/usr/share/doc/qt/qtcore/qxmlstreamnotationdeclaration.html
/usr/share/doc/qt/qtcore/qxmlstreamreader-members.html
/usr/share/doc/qt/qtcore/qxmlstreamreader.html
/usr/share/doc/qt/qtcore/qxmlstreamwriter-members.html
/usr/share/doc/qt/qtcore/qxmlstreamwriter.html
/usr/share/doc/qt/qtcore/resources.html
/usr/share/doc/qt/qtcore/shared.html
/usr/share/doc/qt/qtcore/signalsandslots.html
/usr/share/doc/qt/qtcore/statemachine-api.html
/usr/share/doc/qt/qtcore/statemachine.html
/usr/share/doc/qt/qtcore/timers.html
/usr/share/doc/qt/qtcore/images/abstract-connections.png
/usr/share/doc/qt/qtcore/images/animations-architecture.png
/usr/share/doc/qt/qtcore/images/arrow_bc.png
/usr/share/doc/qt/qtcore/images/bgrContent.png
/usr/share/doc/qt/qtcore/images/brush-styles.png
/usr/share/doc/qt/qtcore/images/btn_next.png
/usr/share/doc/qt/qtcore/images/btn_prev.png
/usr/share/doc/qt/qtcore/images/bullet_dn.png
/usr/share/doc/qt/qtcore/images/bullet_sq.png
/usr/share/doc/qt/qtcore/images/cursor-arrow.png
/usr/share/doc/qt/qtcore/images/cursor-busy.png
/usr/share/doc/qt/qtcore/images/cursor-closedhand.png
/usr/share/doc/qt/qtcore/images/cursor-cross.png
/usr/share/doc/qt/qtcore/images/cursor-forbidden.png
/usr/share/doc/qt/qtcore/images/cursor-hand.png
/usr/share/doc/qt/qtcore/images/cursor-hsplit.png
/usr/share/doc/qt/qtcore/images/cursor-ibeam.png
/usr/share/doc/qt/qtcore/images/cursor-openhand.png
/usr/share/doc/qt/qtcore/images/cursor-sizeall.png
/usr/share/doc/qt/qtcore/images/cursor-sizeb.png
/usr/share/doc/qt/qtcore/images/cursor-sizef.png
/usr/share/doc/qt/qtcore/images/cursor-sizeh.png
/usr/share/doc/qt/qtcore/images/cursor-sizev.png
/usr/share/doc/qt/qtcore/images/cursor-uparrow.png
/usr/share/doc/qt/qtcore/images/cursor-vsplit.png
/usr/share/doc/qt/qtcore/images/cursor-wait.png
/usr/share/doc/qt/qtcore/images/cursor-whatsthis.png
/usr/share/doc/qt/qtcore/images/home.png
/usr/share/doc/qt/qtcore/images/ico_note.png
/usr/share/doc/qt/qtcore/images/ico_note_attention.png
/usr/share/doc/qt/qtcore/images/ico_out.png
/usr/share/doc/qt/qtcore/images/javaiterators1.png
/usr/share/doc/qt/qtcore/images/javaiterators2.png
/usr/share/doc/qt/qtcore/images/localfortuneclient-example.png
/usr/share/doc/qt/qtcore/images/localfortuneserver-example.png
/usr/share/doc/qt/qtcore/images/logo.png
/usr/share/doc/qt/qtcore/images/mandelbrot-example.png
/usr/share/doc/qt/qtcore/images/mandelbrot_scroll1.png
/usr/share/doc/qt/qtcore/images/mandelbrot_scroll2.png
/usr/share/doc/qt/qtcore/images/mandelbrot_scroll3.png
/usr/share/doc/qt/qtcore/images/mandelbrot_zoom1.png
/usr/share/doc/qt/qtcore/images/mandelbrot_zoom2.png
/usr/share/doc/qt/qtcore/images/mandelbrot_zoom3.png
/usr/share/doc/qt/qtcore/images/mimetypebrowser.png
/usr/share/doc/qt/qtcore/images/modelindex-no-parent.png
/usr/share/doc/qt/qtcore/images/modelview-begin-append-columns.png
/usr/share/doc/qt/qtcore/images/modelview-begin-append-rows.png
/usr/share/doc/qt/qtcore/images/modelview-begin-insert-columns.png
/usr/share/doc/qt/qtcore/images/modelview-begin-insert-rows.png
/usr/share/doc/qt/qtcore/images/modelview-begin-remove-columns.png
/usr/share/doc/qt/qtcore/images/modelview-begin-remove-rows.png
/usr/share/doc/qt/qtcore/images/modelview-move-rows-1.png
/usr/share/doc/qt/qtcore/images/modelview-move-rows-2.png
/usr/share/doc/qt/qtcore/images/modelview-move-rows-3.png
/usr/share/doc/qt/qtcore/images/modelview-move-rows-4.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-inback.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-inbounce.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-incirc.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-incubic.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-inelastic.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-inexpo.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-inoutback.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-inoutbounce.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-inoutcirc.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-inoutcubic.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-inoutelastic.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-inoutexpo.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-inoutquad.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-inoutquart.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-inoutquint.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-inoutsine.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-inquad.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-inquart.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-inquint.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-insine.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-linear.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-outback.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-outbounce.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-outcirc.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-outcubic.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-outelastic.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-outexpo.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-outinback.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-outinbounce.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-outincirc.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-outincubic.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-outinelastic.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-outinexpo.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-outinquad.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-outinquart.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-outinquint.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-outinsine.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-outquad.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-outquart.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-outquint.png
/usr/share/doc/qt/qtcore/images/qeasingcurve-outsine.png
/usr/share/doc/qt/qtcore/images/qimage-scaling.png
/usr/share/doc/qt/qtcore/images/qline-coordinates.png
/usr/share/doc/qt/qtcore/images/qline-point.png
/usr/share/doc/qt/qtcore/images/qlinef-angle-identicaldirection.png
/usr/share/doc/qt/qtcore/images/qlinef-angle-oppositedirection.png
/usr/share/doc/qt/qtcore/images/qlinef-bounded.png
/usr/share/doc/qt/qtcore/images/qlinef-normalvector.png
/usr/share/doc/qt/qtcore/images/qlinef-unbounded.png
/usr/share/doc/qt/qtcore/images/qpen-bevel.png
/usr/share/doc/qt/qtcore/images/qpen-custom.png
/usr/share/doc/qt/qtcore/images/qpen-dash.png
/usr/share/doc/qt/qtcore/images/qpen-dashdot.png
/usr/share/doc/qt/qtcore/images/qpen-dashdotdot.png
/usr/share/doc/qt/qtcore/images/qpen-dot.png
/usr/share/doc/qt/qtcore/images/qpen-flat.png
/usr/share/doc/qt/qtcore/images/qpen-miter.png
/usr/share/doc/qt/qtcore/images/qpen-roundcap.png
/usr/share/doc/qt/qtcore/images/qpen-roundjoin.png
/usr/share/doc/qt/qtcore/images/qpen-solid.png
/usr/share/doc/qt/qtcore/images/qpen-square.png
/usr/share/doc/qt/qtcore/images/qrect-coordinates.png
/usr/share/doc/qt/qtcore/images/qrect-diagram-one.png
/usr/share/doc/qt/qtcore/images/qrect-diagram-three.png
/usr/share/doc/qt/qtcore/images/qrect-diagram-two.png
/usr/share/doc/qt/qtcore/images/qrect-diagram-zero.png
/usr/share/doc/qt/qtcore/images/qrect-intersect.png
/usr/share/doc/qt/qtcore/images/qrect-unite.png
/usr/share/doc/qt/qtcore/images/qrectf-coordinates.png
/usr/share/doc/qt/qtcore/images/qrectf-diagram-one.png
/usr/share/doc/qt/qtcore/images/qrectf-diagram-three.png
/usr/share/doc/qt/qtcore/images/qrectf-diagram-two.png
/usr/share/doc/qt/qtcore/images/qsortfilterproxymodel-sorting.png
/usr/share/doc/qt/qtcore/images/queuedcustomtype-example.png
/usr/share/doc/qt/qtcore/images/qurl-authority.png
/usr/share/doc/qt/qtcore/images/qurl-authority2.png
/usr/share/doc/qt/qtcore/images/qurl-authority3.png
/usr/share/doc/qt/qtcore/images/qurl-fragment.png
/usr/share/doc/qt/qtcore/images/qurl-ftppath.png
/usr/share/doc/qt/qtcore/images/qurl-mailtopath.png
/usr/share/doc/qt/qtcore/images/qurl-querystring.png
/usr/share/doc/qt/qtcore/images/resources.png
/usr/share/doc/qt/qtcore/images/sharedmemory-example_1.png
/usr/share/doc/qt/qtcore/images/sharedmemory-example_2.png
/usr/share/doc/qt/qtcore/images/statemachine-button-history.png
/usr/share/doc/qt/qtcore/images/statemachine-button-nested.png
/usr/share/doc/qt/qtcore/images/statemachine-button.png
/usr/share/doc/qt/qtcore/images/statemachine-customevents.png
/usr/share/doc/qt/qtcore/images/statemachine-customevents2.png
/usr/share/doc/qt/qtcore/images/statemachine-finished.png
/usr/share/doc/qt/qtcore/images/statemachine-nonparallel.png
/usr/share/doc/qt/qtcore/images/statemachine-parallel.png
/usr/share/doc/qt/qtcore/images/stliterators1.png
/usr/share/doc/qt/qtcore/style/offline-simple.css
/usr/share/doc/qt/qtcore/style/offline.css
/usr/share/doc/qt/qtdatavisualization/datavisualization-examples.html
/usr/share/doc/qt/qtdatavisualization/examples-manifest.xml
/usr/share/doc/qt/qtdatavisualization/q3dbars-members.html
/usr/share/doc/qt/qtdatavisualization/q3dbars.html
/usr/share/doc/qt/qtdatavisualization/q3dcamera-members.html
/usr/share/doc/qt/qtdatavisualization/q3dcamera.html
/usr/share/doc/qt/qtdatavisualization/q3dinputhandler-members.html
/usr/share/doc/qt/qtdatavisualization/q3dinputhandler.html
/usr/share/doc/qt/qtdatavisualization/q3dlight-members.html
/usr/share/doc/qt/qtdatavisualization/q3dlight.html
/usr/share/doc/qt/qtdatavisualization/q3dobject-members.html
/usr/share/doc/qt/qtdatavisualization/q3dobject.html
/usr/share/doc/qt/qtdatavisualization/q3dscatter-members.html
/usr/share/doc/qt/qtdatavisualization/q3dscatter.html
/usr/share/doc/qt/qtdatavisualization/q3dscene-members.html
/usr/share/doc/qt/qtdatavisualization/q3dscene.html
/usr/share/doc/qt/qtdatavisualization/q3dsurface-members.html
/usr/share/doc/qt/qtdatavisualization/q3dsurface.html
/usr/share/doc/qt/qtdatavisualization/q3dtheme-members.html
/usr/share/doc/qt/qtdatavisualization/q3dtheme.html
/usr/share/doc/qt/qtdatavisualization/qabstract3daxis-members.html
/usr/share/doc/qt/qtdatavisualization/qabstract3daxis.html
/usr/share/doc/qt/qtdatavisualization/qabstract3dgraph-members.html
/usr/share/doc/qt/qtdatavisualization/qabstract3dgraph.html
/usr/share/doc/qt/qtdatavisualization/qabstract3dinputhandler-members.html
/usr/share/doc/qt/qtdatavisualization/qabstract3dinputhandler.html
/usr/share/doc/qt/qtdatavisualization/qabstract3dseries-members.html
/usr/share/doc/qt/qtdatavisualization/qabstract3dseries.html
/usr/share/doc/qt/qtdatavisualization/qabstractdataproxy-members.html
/usr/share/doc/qt/qtdatavisualization/qabstractdataproxy.html
/usr/share/doc/qt/qtdatavisualization/qbar3dseries-members.html
/usr/share/doc/qt/qtdatavisualization/qbar3dseries.html
/usr/share/doc/qt/qtdatavisualization/qbardataitem-members.html
/usr/share/doc/qt/qtdatavisualization/qbardataitem.html
/usr/share/doc/qt/qtdatavisualization/qbardataproxy-members.html
/usr/share/doc/qt/qtdatavisualization/qbardataproxy.html
/usr/share/doc/qt/qtdatavisualization/qcategory3daxis-members.html
/usr/share/doc/qt/qtdatavisualization/qcategory3daxis.html
/usr/share/doc/qt/qtdatavisualization/qcustom3ditem-members.html
/usr/share/doc/qt/qtdatavisualization/qcustom3ditem.html
/usr/share/doc/qt/qtdatavisualization/qcustom3dlabel-members.html
/usr/share/doc/qt/qtdatavisualization/qcustom3dlabel.html
/usr/share/doc/qt/qtdatavisualization/qcustom3dvolume-members.html
/usr/share/doc/qt/qtdatavisualization/qcustom3dvolume.html
/usr/share/doc/qt/qtdatavisualization/qheightmapsurfacedataproxy-members.html
/usr/share/doc/qt/qtdatavisualization/qheightmapsurfacedataproxy.html
/usr/share/doc/qt/qtdatavisualization/qitemmodelbardataproxy-members.html
/usr/share/doc/qt/qtdatavisualization/qitemmodelbardataproxy.html
/usr/share/doc/qt/qtdatavisualization/qitemmodelscatterdataproxy-members.html
/usr/share/doc/qt/qtdatavisualization/qitemmodelscatterdataproxy.html
/usr/share/doc/qt/qtdatavisualization/qitemmodelsurfacedataproxy-members.html
/usr/share/doc/qt/qtdatavisualization/qitemmodelsurfacedataproxy.html
/usr/share/doc/qt/qtdatavisualization/qlogvalue3daxisformatter-members.html
/usr/share/doc/qt/qtdatavisualization/qlogvalue3daxisformatter.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-abstract3dseries-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-abstract3dseries.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-abstractaxis3d-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-abstractaxis3d.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-abstractdataproxy-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-abstractdataproxy.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-abstractgraph3d-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-abstractgraph3d.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-abstractinputhandler3d-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-abstractinputhandler3d.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-bar3dseries-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-bar3dseries.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-bardataproxy-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-bardataproxy.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-bars3d-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-bars3d.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-camera3d-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-camera3d.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-categoryaxis3d-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-categoryaxis3d.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-colorgradient-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-colorgradient.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-colorgradientstop-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-colorgradientstop.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-custom3ditem-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-custom3ditem.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-custom3dlabel-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-custom3dlabel.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-custom3dvolume-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-custom3dvolume.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-heightmapsurfacedataproxy-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-heightmapsurfacedataproxy.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-inputhandler3d-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-inputhandler3d.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-itemmodelbardataproxy-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-itemmodelbardataproxy.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-itemmodelscatterdataproxy-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-itemmodelscatterdataproxy.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-itemmodelsurfacedataproxy-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-itemmodelsurfacedataproxy.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-light3d-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-light3d.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-logvalueaxis3dformatter-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-logvalueaxis3dformatter.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-object3d-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-object3d.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-scatter3d-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-scatter3d.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-scatter3dseries-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-scatter3dseries.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-scatterdataproxy-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-scatterdataproxy.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-scene3d-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-scene3d.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-surface3d-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-surface3d.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-surface3dseries-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-surface3dseries.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-surfacedataproxy-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-surfacedataproxy.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-theme3d-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-theme3d.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-themecolor-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-themecolor.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-touchinputhandler3d-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-touchinputhandler3d.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-valueaxis3d-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-valueaxis3d.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-valueaxis3dformatter-members.html
/usr/share/doc/qt/qtdatavisualization/qml-qtdatavisualization-valueaxis3dformatter.html
/usr/share/doc/qt/qtdatavisualization/qscatter3dseries-members.html
/usr/share/doc/qt/qtdatavisualization/qscatter3dseries.html
/usr/share/doc/qt/qtdatavisualization/qscatterdataitem-members.html
/usr/share/doc/qt/qtdatavisualization/qscatterdataitem.html
/usr/share/doc/qt/qtdatavisualization/qscatterdataproxy-members.html
/usr/share/doc/qt/qtdatavisualization/qscatterdataproxy.html
/usr/share/doc/qt/qtdatavisualization/qsurface3dseries-members.html
/usr/share/doc/qt/qtdatavisualization/qsurface3dseries.html
/usr/share/doc/qt/qtdatavisualization/qsurfacedataitem-members.html
/usr/share/doc/qt/qtdatavisualization/qsurfacedataitem.html
/usr/share/doc/qt/qtdatavisualization/qsurfacedataproxy-members.html
/usr/share/doc/qt/qtdatavisualization/qsurfacedataproxy.html
/usr/share/doc/qt/qtdatavisualization/qtdatavis3d.qhp
/usr/share/doc/qt/qtdatavisualization/qtdatavis3d.qhp.sha1
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-audiolevels-example.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-bars-example.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-custominput-example.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-customitems-example.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-customproxy-example.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-data-handling.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-draggableaxes-example.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-index.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-interacting-with-data.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-itemmodel-example.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-known-issues.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-module.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-overview.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlaxisdrag-example.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlaxisformatter-example.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlbars-example.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlcustominput-example.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmllegend-example.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlmodule.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlmultigraph-example.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmloscilloscope-example.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlscatter-example.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlspectrogram-example.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlsurface-example.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-qmlsurfacelayers-example.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-rotations-example.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-scatter-example.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-surface-example.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-texturesurface-example.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization-volumetric-example.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization.html
/usr/share/doc/qt/qtdatavisualization/qtdatavisualization.index
/usr/share/doc/qt/qtdatavisualization/qtouch3dinputhandler-members.html
/usr/share/doc/qt/qtdatavisualization/qtouch3dinputhandler.html
/usr/share/doc/qt/qtdatavisualization/qvalue3daxis-members.html
/usr/share/doc/qt/qtdatavisualization/qvalue3daxis.html
/usr/share/doc/qt/qtdatavisualization/qvalue3daxisformatter-members.html
/usr/share/doc/qt/qtdatavisualization/qvalue3daxisformatter.html
/usr/share/doc/qt/qtdatavisualization/images/arrow_bc.png
/usr/share/doc/qt/qtdatavisualization/images/audiolevels-example.png
/usr/share/doc/qt/qtdatavisualization/images/bars-example.png
/usr/share/doc/qt/qtdatavisualization/images/bgrContent.png
/usr/share/doc/qt/qtdatavisualization/images/btn_next.png
/usr/share/doc/qt/qtdatavisualization/images/btn_prev.png
/usr/share/doc/qt/qtdatavisualization/images/bullet_dn.png
/usr/share/doc/qt/qtdatavisualization/images/bullet_sq.png
/usr/share/doc/qt/qtdatavisualization/images/custominput-example.png
/usr/share/doc/qt/qtdatavisualization/images/customitems-example.png
/usr/share/doc/qt/qtdatavisualization/images/customproxy-example.png
/usr/share/doc/qt/qtdatavisualization/images/draggableaxes-example.png
/usr/share/doc/qt/qtdatavisualization/images/home.png
/usr/share/doc/qt/qtdatavisualization/images/ico_note.png
/usr/share/doc/qt/qtdatavisualization/images/ico_note_attention.png
/usr/share/doc/qt/qtdatavisualization/images/ico_out.png
/usr/share/doc/qt/qtdatavisualization/images/itemmodel-example-2.png
/usr/share/doc/qt/qtdatavisualization/images/itemmodel-example.png
/usr/share/doc/qt/qtdatavisualization/images/logo.png
/usr/share/doc/qt/qtdatavisualization/images/q3dbars-minimal.png
/usr/share/doc/qt/qtdatavisualization/images/q3dscatter-minimal.png
/usr/share/doc/qt/qtdatavisualization/images/q3dsurface-minimal.png
/usr/share/doc/qt/qtdatavisualization/images/qmlaxisdrag-example.png
/usr/share/doc/qt/qtdatavisualization/images/qmlaxisformatter-example.png
/usr/share/doc/qt/qtdatavisualization/images/qmlbars-example.png
/usr/share/doc/qt/qtdatavisualization/images/qmlcustominput-example.png
/usr/share/doc/qt/qtdatavisualization/images/qmllegend-example.png
/usr/share/doc/qt/qtdatavisualization/images/qmlmultigraph-example.png
/usr/share/doc/qt/qtdatavisualization/images/qmloscilloscope-example.png
/usr/share/doc/qt/qtdatavisualization/images/qmlscatter-example.png
/usr/share/doc/qt/qtdatavisualization/images/qmlspectrogram-example.png
/usr/share/doc/qt/qtdatavisualization/images/qmlsurface-example.png
/usr/share/doc/qt/qtdatavisualization/images/qmlsurfacelayers-example.png
/usr/share/doc/qt/qtdatavisualization/images/rotations-example.png
/usr/share/doc/qt/qtdatavisualization/images/scatter-example.png
/usr/share/doc/qt/qtdatavisualization/images/surface-example.png
/usr/share/doc/qt/qtdatavisualization/images/texturesurface-example.png
/usr/share/doc/qt/qtdatavisualization/images/volumetric-example.png
/usr/share/doc/qt/qtdatavisualization/style/offline-simple.css
/usr/share/doc/qt/qtdatavisualization/style/offline.css
/usr/share/doc/qt/qtdbus/examples-dbus.html
/usr/share/doc/qt/qtdbus/examples-manifest.xml
/usr/share/doc/qt/qtdbus/qdbus.html
/usr/share/doc/qt/qtdbus/qdbusabstractadaptor-members.html
/usr/share/doc/qt/qtdbus/qdbusabstractadaptor.html
/usr/share/doc/qt/qtdbus/qdbusabstractinterface-members.html
/usr/share/doc/qt/qtdbus/qdbusabstractinterface.html
/usr/share/doc/qt/qtdbus/qdbusargument-members.html
/usr/share/doc/qt/qtdbus/qdbusargument.html
/usr/share/doc/qt/qtdbus/qdbusconnection-members.html
/usr/share/doc/qt/qtdbus/qdbusconnection-obsolete.html
/usr/share/doc/qt/qtdbus/qdbusconnection.html
/usr/share/doc/qt/qtdbus/qdbusconnectioninterface-members.html
/usr/share/doc/qt/qtdbus/qdbusconnectioninterface-obsolete.html
/usr/share/doc/qt/qtdbus/qdbusconnectioninterface.html
/usr/share/doc/qt/qtdbus/qdbuscontext-members.html
/usr/share/doc/qt/qtdbus/qdbuscontext.html
/usr/share/doc/qt/qtdbus/qdbusdeclaringsignals.html
/usr/share/doc/qt/qtdbus/qdbusdeclaringslots.html
/usr/share/doc/qt/qtdbus/qdbuserror-members.html
/usr/share/doc/qt/qtdbus/qdbuserror.html
/usr/share/doc/qt/qtdbus/qdbusinterface-members.html
/usr/share/doc/qt/qtdbus/qdbusinterface.html
/usr/share/doc/qt/qtdbus/qdbusmessage-members.html
/usr/share/doc/qt/qtdbus/qdbusmessage.html
/usr/share/doc/qt/qtdbus/qdbusobjectpath-members.html
/usr/share/doc/qt/qtdbus/qdbusobjectpath.html
/usr/share/doc/qt/qtdbus/qdbuspendingcall-members.html
/usr/share/doc/qt/qtdbus/qdbuspendingcall.html
/usr/share/doc/qt/qtdbus/qdbuspendingcallwatcher-members.html
/usr/share/doc/qt/qtdbus/qdbuspendingcallwatcher.html
/usr/share/doc/qt/qtdbus/qdbuspendingreply-members.html
/usr/share/doc/qt/qtdbus/qdbuspendingreply.html
/usr/share/doc/qt/qtdbus/qdbusreply-members.html
/usr/share/doc/qt/qtdbus/qdbusreply.html
/usr/share/doc/qt/qtdbus/qdbusserver-members.html
/usr/share/doc/qt/qtdbus/qdbusserver.html
/usr/share/doc/qt/qtdbus/qdbusservicewatcher-members.html
/usr/share/doc/qt/qtdbus/qdbusservicewatcher.html
/usr/share/doc/qt/qtdbus/qdbussignature-members.html
/usr/share/doc/qt/qtdbus/qdbussignature.html
/usr/share/doc/qt/qtdbus/qdbustypesystem.html
/usr/share/doc/qt/qtdbus/qdbusunixfiledescriptor-members.html
/usr/share/doc/qt/qtdbus/qdbusunixfiledescriptor.html
/usr/share/doc/qt/qtdbus/qdbusvariant-members.html
/usr/share/doc/qt/qtdbus/qdbusvariant.html
/usr/share/doc/qt/qtdbus/qdbusviewer.html
/usr/share/doc/qt/qtdbus/qdbusvirtualobject-members.html
/usr/share/doc/qt/qtdbus/qdbusvirtualobject.html
/usr/share/doc/qt/qtdbus/qdbusxml2cpp.html
/usr/share/doc/qt/qtdbus/qtdbus-attribution-libdbus-1-headers.html
/usr/share/doc/qt/qtdbus/qtdbus-chat-example.html
/usr/share/doc/qt/qtdbus/qtdbus-cmake-qt5-add-dbus-adaptor.html
/usr/share/doc/qt/qtdbus/qtdbus-cmake-qt5-add-dbus-interface.html
/usr/share/doc/qt/qtdbus/qtdbus-cmake-qt5-add-dbus-interfaces.html
/usr/share/doc/qt/qtdbus/qtdbus-cmake-qt5-generate-dbus-interface.html
/usr/share/doc/qt/qtdbus/qtdbus-complexpingpong-example.html
/usr/share/doc/qt/qtdbus/qtdbus-index.html
/usr/share/doc/qt/qtdbus/qtdbus-listnames-example.html
/usr/share/doc/qt/qtdbus/qtdbus-module.html
/usr/share/doc/qt/qtdbus/qtdbus-pingpong-example.html
/usr/share/doc/qt/qtdbus/qtdbus-remotecontrolledcar-example.html
/usr/share/doc/qt/qtdbus/qtdbus.index
/usr/share/doc/qt/qtdbus/qtdbus.qhp
/usr/share/doc/qt/qtdbus/qtdbus.qhp.sha1
/usr/share/doc/qt/qtdbus/qtdbus.tags
/usr/share/doc/qt/qtdbus/usingadaptors.html
/usr/share/doc/qt/qtdbus/images/arrow_bc.png
/usr/share/doc/qt/qtdbus/images/bgrContent.png
/usr/share/doc/qt/qtdbus/images/btn_next.png
/usr/share/doc/qt/qtdbus/images/btn_prev.png
/usr/share/doc/qt/qtdbus/images/bullet_dn.png
/usr/share/doc/qt/qtdbus/images/bullet_sq.png
/usr/share/doc/qt/qtdbus/images/dbus-chat-example.png
/usr/share/doc/qt/qtdbus/images/home.png
/usr/share/doc/qt/qtdbus/images/ico_note.png
/usr/share/doc/qt/qtdbus/images/ico_note_attention.png
/usr/share/doc/qt/qtdbus/images/ico_out.png
/usr/share/doc/qt/qtdbus/images/logo.png
/usr/share/doc/qt/qtdbus/images/qurl-ftppath.png
/usr/share/doc/qt/qtdbus/images/remotecontrolledcar-car-example.png
/usr/share/doc/qt/qtdbus/style/offline-simple.css
/usr/share/doc/qt/qtdbus/style/offline.css
/usr/share/doc/qt/qtdesigner/designer-buddy-mode.html
/usr/share/doc/qt/qtdesigner/designer-connection-mode.html
/usr/share/doc/qt/qtdesigner/designer-creating-custom-widgets-extensions.html
/usr/share/doc/qt/qtdesigner/designer-creating-custom-widgets.html
/usr/share/doc/qt/qtdesigner/designer-creating-mainwindows.html
/usr/share/doc/qt/qtdesigner/designer-customizing-forms.html
/usr/share/doc/qt/qtdesigner/designer-editing-mode.html
/usr/share/doc/qt/qtdesigner/designer-layouts.html
/usr/share/doc/qt/qtdesigner/designer-preview.html
/usr/share/doc/qt/qtdesigner/designer-quick-start.html
/usr/share/doc/qt/qtdesigner/designer-resources.html
/usr/share/doc/qt/qtdesigner/designer-stylesheet.html
/usr/share/doc/qt/qtdesigner/designer-tab-order.html
/usr/share/doc/qt/qtdesigner/designer-to-know.html
/usr/share/doc/qt/qtdesigner/designer-ui-file-format.html
/usr/share/doc/qt/qtdesigner/designer-using-a-ui-file.html
/usr/share/doc/qt/qtdesigner/designer-using-containers.html
/usr/share/doc/qt/qtdesigner/designer-using-custom-widgets.html
/usr/share/doc/qt/qtdesigner/designer-widget-mode.html
/usr/share/doc/qt/qtdesigner/examples-designer.html
/usr/share/doc/qt/qtdesigner/examples-manifest.xml
/usr/share/doc/qt/qtdesigner/qabstractextensionfactory-members.html
/usr/share/doc/qt/qtdesigner/qabstractextensionfactory.html
/usr/share/doc/qt/qtdesigner/qabstractextensionmanager-members.html
/usr/share/doc/qt/qtdesigner/qabstractextensionmanager.html
/usr/share/doc/qt/qtdesigner/qabstractformbuilder-members.html
/usr/share/doc/qt/qtdesigner/qabstractformbuilder.html
/usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerformwindowmanager-members.html
/usr/share/doc/qt/qtdesigner/qdesigner-internal-qdesignerformwindowmanager.html
/usr/share/doc/qt/qtdesigner/qdesigner-internal-sub-qtdesigner.html
/usr/share/doc/qt/qtdesigner/qdesigneractioneditorinterface-members.html
/usr/share/doc/qt/qtdesigner/qdesigneractioneditorinterface.html
/usr/share/doc/qt/qtdesigner/qdesignercontainerextension-members.html
/usr/share/doc/qt/qtdesigner/qdesignercontainerextension.html
/usr/share/doc/qt/qtdesigner/qdesignercustomwidgetcollectioninterface-members.html
/usr/share/doc/qt/qtdesigner/qdesignercustomwidgetcollectioninterface.html
/usr/share/doc/qt/qtdesigner/qdesignercustomwidgetinterface-members.html
/usr/share/doc/qt/qtdesigner/qdesignercustomwidgetinterface.html
/usr/share/doc/qt/qtdesigner/qdesignerdynamicpropertysheetextension-members.html
/usr/share/doc/qt/qtdesigner/qdesignerdynamicpropertysheetextension.html
/usr/share/doc/qt/qtdesigner/qdesignerformeditorinterface-members.html
/usr/share/doc/qt/qtdesigner/qdesignerformeditorinterface.html
/usr/share/doc/qt/qtdesigner/qdesignerformwindowcursorinterface-members.html
/usr/share/doc/qt/qtdesigner/qdesignerformwindowcursorinterface.html
/usr/share/doc/qt/qtdesigner/qdesignerformwindowinterface-members.html
/usr/share/doc/qt/qtdesigner/qdesignerformwindowinterface.html
/usr/share/doc/qt/qtdesigner/qdesignerformwindowmanagerinterface-members.html
/usr/share/doc/qt/qtdesigner/qdesignerformwindowmanagerinterface-obsolete.html
/usr/share/doc/qt/qtdesigner/qdesignerformwindowmanagerinterface.html
/usr/share/doc/qt/qtdesigner/qdesignermembersheetextension-members.html
/usr/share/doc/qt/qtdesigner/qdesignermembersheetextension.html
/usr/share/doc/qt/qtdesigner/qdesignerobjectinspectorinterface-members.html
/usr/share/doc/qt/qtdesigner/qdesignerobjectinspectorinterface.html
/usr/share/doc/qt/qtdesigner/qdesignerpropertyeditorinterface-members.html
/usr/share/doc/qt/qtdesigner/qdesignerpropertyeditorinterface.html
/usr/share/doc/qt/qtdesigner/qdesignerpropertysheetextension-members.html
/usr/share/doc/qt/qtdesigner/qdesignerpropertysheetextension.html
/usr/share/doc/qt/qtdesigner/qdesignertaskmenuextension-members.html
/usr/share/doc/qt/qtdesigner/qdesignertaskmenuextension.html
/usr/share/doc/qt/qtdesigner/qdesignerwidgetboxinterface-members.html
/usr/share/doc/qt/qtdesigner/qdesignerwidgetboxinterface.html
/usr/share/doc/qt/qtdesigner/qextensionfactory-members.html
/usr/share/doc/qt/qtdesigner/qextensionfactory.html
/usr/share/doc/qt/qtdesigner/qextensionmanager-members.html
/usr/share/doc/qt/qtdesigner/qextensionmanager.html
/usr/share/doc/qt/qtdesigner/qformbuilder-members.html
/usr/share/doc/qt/qtdesigner/qformbuilder.html
/usr/share/doc/qt/qtdesigner/qtdesigner-calculatorbuilder-example.html
/usr/share/doc/qt/qtdesigner/qtdesigner-calculatorform-example.html
/usr/share/doc/qt/qtdesigner/qtdesigner-components.html
/usr/share/doc/qt/qtdesigner/qtdesigner-containerextension-example.html
/usr/share/doc/qt/qtdesigner/qtdesigner-customwidgetplugin-example.html
/usr/share/doc/qt/qtdesigner/qtdesigner-index.html
/usr/share/doc/qt/qtdesigner/qtdesigner-manual.html
/usr/share/doc/qt/qtdesigner/qtdesigner-module.html
/usr/share/doc/qt/qtdesigner/qtdesigner-taskmenuextension-example.html
/usr/share/doc/qt/qtdesigner/qtdesigner-worldtimeclockbuilder-example.html
/usr/share/doc/qt/qtdesigner/qtdesigner-worldtimeclockplugin-example.html
/usr/share/doc/qt/qtdesigner/qtdesigner.index
/usr/share/doc/qt/qtdesigner/qtdesigner.qhp
/usr/share/doc/qt/qtdesigner/qtdesigner.qhp.sha1
/usr/share/doc/qt/qtdesigner/images/addressbook-tutorial-part3-labeled-layout.png
/usr/share/doc/qt/qtdesigner/images/arrow_bc.png
/usr/share/doc/qt/qtdesigner/images/bgrContent.png
/usr/share/doc/qt/qtdesigner/images/btn_next.png
/usr/share/doc/qt/qtdesigner/images/btn_prev.png
/usr/share/doc/qt/qtdesigner/images/bullet_dn.png
/usr/share/doc/qt/qtdesigner/images/bullet_sq.png
/usr/share/doc/qt/qtdesigner/images/calculatorbuilder-example.png
/usr/share/doc/qt/qtdesigner/images/calculatorform-example.png
/usr/share/doc/qt/qtdesigner/images/containerextension-example.png
/usr/share/doc/qt/qtdesigner/images/customwidgetplugin-example.png
/usr/share/doc/qt/qtdesigner/images/designer-action-editor.png
/usr/share/doc/qt/qtdesigner/images/designer-add-files-button.png
/usr/share/doc/qt/qtdesigner/images/designer-add-resource-entry-button.png
/usr/share/doc/qt/qtdesigner/images/designer-adding-dockwidget.png
/usr/share/doc/qt/qtdesigner/images/designer-adding-menu-action.png
/usr/share/doc/qt/qtdesigner/images/designer-adding-toolbar-action.png
/usr/share/doc/qt/qtdesigner/images/designer-buddy-making.png
/usr/share/doc/qt/qtdesigner/images/designer-buddy-mode.png
/usr/share/doc/qt/qtdesigner/images/designer-buddy-tool.png
/usr/share/doc/qt/qtdesigner/images/designer-choosing-form.png
/usr/share/doc/qt/qtdesigner/images/designer-code-viewer.png
/usr/share/doc/qt/qtdesigner/images/designer-connection-dialog.png
/usr/share/doc/qt/qtdesigner/images/designer-connection-editing.png
/usr/share/doc/qt/qtdesigner/images/designer-connection-editor.png
/usr/share/doc/qt/qtdesigner/images/designer-connection-highlight.png
/usr/share/doc/qt/qtdesigner/images/designer-connection-making.png
/usr/share/doc/qt/qtdesigner/images/designer-connection-mode.png
/usr/share/doc/qt/qtdesigner/images/designer-connection-to-form.png
/usr/share/doc/qt/qtdesigner/images/designer-connection-tool.png
/usr/share/doc/qt/qtdesigner/images/designer-containers-dockwidget.png
/usr/share/doc/qt/qtdesigner/images/designer-containers-frame.png
/usr/share/doc/qt/qtdesigner/images/designer-containers-groupbox.png
/usr/share/doc/qt/qtdesigner/images/designer-containers-stackedwidget.png
/usr/share/doc/qt/qtdesigner/images/designer-containers-tabwidget.png
/usr/share/doc/qt/qtdesigner/images/designer-containers-toolbox.png
/usr/share/doc/qt/qtdesigner/images/designer-creating-menu-entry1.png
/usr/share/doc/qt/qtdesigner/images/designer-creating-menu-entry2.png
/usr/share/doc/qt/qtdesigner/images/designer-creating-menu-entry3.png
/usr/share/doc/qt/qtdesigner/images/designer-creating-menu-entry4.png
/usr/share/doc/qt/qtdesigner/images/designer-creating-menu1.png
/usr/share/doc/qt/qtdesigner/images/designer-creating-menu2.png
/usr/share/doc/qt/qtdesigner/images/designer-creating-menu3.png
/usr/share/doc/qt/qtdesigner/images/designer-creating-menu4.png
/usr/share/doc/qt/qtdesigner/images/designer-creating-toolbar.png
/usr/share/doc/qt/qtdesigner/images/designer-dialog-preview.png
/usr/share/doc/qt/qtdesigner/images/designer-dragging-onto-form.png
/usr/share/doc/qt/qtdesigner/images/designer-edit-resource.png
/usr/share/doc/qt/qtdesigner/images/designer-edit-resources-button.png
/usr/share/doc/qt/qtdesigner/images/designer-editing-mode.png
/usr/share/doc/qt/qtdesigner/images/designer-english-dialog.png
/usr/share/doc/qt/qtdesigner/images/designer-file-menu.png
/usr/share/doc/qt/qtdesigner/images/designer-form-layout-cleanlooks.png
/usr/share/doc/qt/qtdesigner/images/designer-form-layout-macintosh.png
/usr/share/doc/qt/qtdesigner/images/designer-form-layout-windowsXP.png
/usr/share/doc/qt/qtdesigner/images/designer-form-layout.png
/usr/share/doc/qt/qtdesigner/images/designer-form-layoutfunction.png
/usr/share/doc/qt/qtdesigner/images/designer-form-settings.png
/usr/share/doc/qt/qtdesigner/images/designer-form-viewcode.png
/usr/share/doc/qt/qtdesigner/images/designer-french-dialog.png
/usr/share/doc/qt/qtdesigner/images/designer-layout-inserting.png
/usr/share/doc/qt/qtdesigner/images/designer-main-window.png
/usr/share/doc/qt/qtdesigner/images/designer-manual-containerextension.png
/usr/share/doc/qt/qtdesigner/images/designer-manual-membersheetextension.png
/usr/share/doc/qt/qtdesigner/images/designer-manual-propertysheetextension.png
/usr/share/doc/qt/qtdesigner/images/designer-manual-taskmenuextension.png
/usr/share/doc/qt/qtdesigner/images/designer-multiple-screenshot.png
/usr/share/doc/qt/qtdesigner/images/designer-object-inspector.png
/usr/share/doc/qt/qtdesigner/images/designer-preview-deviceskin-selection.png
/usr/share/doc/qt/qtdesigner/images/designer-preview-style-selection.png
/usr/share/doc/qt/qtdesigner/images/designer-preview-style.png
/usr/share/doc/qt/qtdesigner/images/designer-preview-stylesheet.png
/usr/share/doc/qt/qtdesigner/images/designer-promoting-widgets.png
/usr/share/doc/qt/qtdesigner/images/designer-property-editor-add-dynamic.png
/usr/share/doc/qt/qtdesigner/images/designer-property-editor-configure.png
/usr/share/doc/qt/qtdesigner/images/designer-property-editor-remove-dynamic.png
/usr/share/doc/qt/qtdesigner/images/designer-property-editor-toolbar.png
/usr/share/doc/qt/qtdesigner/images/designer-property-editor.png
/usr/share/doc/qt/qtdesigner/images/designer-reload-resources-button.png
/usr/share/doc/qt/qtdesigner/images/designer-remove-resource-entry-button.png
/usr/share/doc/qt/qtdesigner/images/designer-removing-toolbar-action.png
/usr/share/doc/qt/qtdesigner/images/designer-resource-browser.png
/usr/share/doc/qt/qtdesigner/images/designer-resource-selector.png
/usr/share/doc/qt/qtdesigner/images/designer-resources-editing.png
/usr/share/doc/qt/qtdesigner/images/designer-resources-using.png
/usr/share/doc/qt/qtdesigner/images/designer-screenshot.png
/usr/share/doc/qt/qtdesigner/images/designer-selecting-widget.png
/usr/share/doc/qt/qtdesigner/images/designer-set-layout.png
/usr/share/doc/qt/qtdesigner/images/designer-set-layout2.png
/usr/share/doc/qt/qtdesigner/images/designer-splitter-layout.png
/usr/share/doc/qt/qtdesigner/images/designer-stylesheet-options.png
/usr/share/doc/qt/qtdesigner/images/designer-stylesheet-usage.png
/usr/share/doc/qt/qtdesigner/images/designer-tab-order-mode.png
/usr/share/doc/qt/qtdesigner/images/designer-tab-order-tool.png
/usr/share/doc/qt/qtdesigner/images/designer-widget-box.png
/usr/share/doc/qt/qtdesigner/images/designer-widget-morph.png
/usr/share/doc/qt/qtdesigner/images/designer-widget-tool.png
/usr/share/doc/qt/qtdesigner/images/directapproach-calculatorform.png
/usr/share/doc/qt/qtdesigner/images/home.png
/usr/share/doc/qt/qtdesigner/images/ico_note.png
/usr/share/doc/qt/qtdesigner/images/ico_note_attention.png
/usr/share/doc/qt/qtdesigner/images/ico_out.png
/usr/share/doc/qt/qtdesigner/images/logo.png
/usr/share/doc/qt/qtdesigner/images/qtdesignerextensions.png
/usr/share/doc/qt/qtdesigner/images/qtdesignerscreenshot.png
/usr/share/doc/qt/qtdesigner/images/rgbController-arrangement.png
/usr/share/doc/qt/qtdesigner/images/rgbController-configure-connection1.png
/usr/share/doc/qt/qtdesigner/images/rgbController-configure-connection2.png
/usr/share/doc/qt/qtdesigner/images/rgbController-final-layout.png
/usr/share/doc/qt/qtdesigner/images/rgbController-form-gridLayout.png
/usr/share/doc/qt/qtdesigner/images/rgbController-no-toplevel-layout.png
/usr/share/doc/qt/qtdesigner/images/rgbController-property-editing.png
/usr/share/doc/qt/qtdesigner/images/rgbController-screenshot.png
/usr/share/doc/qt/qtdesigner/images/rgbController-selectForLayout.png
/usr/share/doc/qt/qtdesigner/images/rgbController-signalsAndSlots.png
/usr/share/doc/qt/qtdesigner/images/taskmenuextension-dialog.png
/usr/share/doc/qt/qtdesigner/images/taskmenuextension-example-faded.png
/usr/share/doc/qt/qtdesigner/images/taskmenuextension-menu.png
/usr/share/doc/qt/qtdesigner/images/worldtimeclock-connection.png
/usr/share/doc/qt/qtdesigner/images/worldtimeclock-signalandslot.png
/usr/share/doc/qt/qtdesigner/images/worldtimeclockbuilder-example.png
/usr/share/doc/qt/qtdesigner/images/worldtimeclockplugin-example.png
/usr/share/doc/qt/qtdesigner/style/offline-simple.css
/usr/share/doc/qt/qtdesigner/style/offline.css
/usr/share/doc/qt/qtdistancefieldgenerator/qtdistancefieldgenerator-index.html
/usr/share/doc/qt/qtdistancefieldgenerator/qtdistancefieldgenerator.index
/usr/share/doc/qt/qtdistancefieldgenerator/qtdistancefieldgenerator.qhp
/usr/share/doc/qt/qtdistancefieldgenerator/qtdistancefieldgenerator.qhp.sha1
/usr/share/doc/qt/qtdistancefieldgenerator/images/arrow_bc.png
/usr/share/doc/qt/qtdistancefieldgenerator/images/bgrContent.png
/usr/share/doc/qt/qtdistancefieldgenerator/images/btn_next.png
/usr/share/doc/qt/qtdistancefieldgenerator/images/btn_prev.png
/usr/share/doc/qt/qtdistancefieldgenerator/images/bullet_dn.png
/usr/share/doc/qt/qtdistancefieldgenerator/images/bullet_sq.png
/usr/share/doc/qt/qtdistancefieldgenerator/images/distancefieldgenerator.png
/usr/share/doc/qt/qtdistancefieldgenerator/images/home.png
/usr/share/doc/qt/qtdistancefieldgenerator/images/ico_note.png
/usr/share/doc/qt/qtdistancefieldgenerator/images/ico_note_attention.png
/usr/share/doc/qt/qtdistancefieldgenerator/images/ico_out.png
/usr/share/doc/qt/qtdistancefieldgenerator/images/logo.png
/usr/share/doc/qt/qtdistancefieldgenerator/style/offline-simple.css
/usr/share/doc/qt/qtdistancefieldgenerator/style/offline.css
/usr/share/doc/qt/qtdoc/accelerators.html
/usr/share/doc/qt/qtdoc/accessibility.html
/usr/share/doc/qt/qtdoc/accessible-qtquick.html
/usr/share/doc/qt/qtdoc/accessible-qwidget.html
/usr/share/doc/qt/qtdoc/accessible.html
/usr/share/doc/qt/qtdoc/activeqt-idc.html
/usr/share/doc/qt/qtdoc/activeqt-testcon.html
/usr/share/doc/qt/qtdoc/activeqt.html
/usr/share/doc/qt/qtdoc/all-examples.html
/usr/share/doc/qt/qtdoc/android-3rdparty-libs.html
/usr/share/doc/qt/qtdoc/android-building.html
/usr/share/doc/qt/qtdoc/android-getting-started.html
/usr/share/doc/qt/qtdoc/android-openssl-support.html
/usr/share/doc/qt/qtdoc/android-platform-notes.html
/usr/share/doc/qt/qtdoc/android-publishing-to-googleplay.html
/usr/share/doc/qt/qtdoc/android-runtime-licensing-notes.html
/usr/share/doc/qt/qtdoc/android-services.html
/usr/share/doc/qt/qtdoc/android.html
/usr/share/doc/qt/qtdoc/annotated.html
/usr/share/doc/qt/qtdoc/appicon.html
/usr/share/doc/qt/qtdoc/atomic-operations.html
/usr/share/doc/qt/qtdoc/best-practices.html
/usr/share/doc/qt/qtdoc/bughowto.html
/usr/share/doc/qt/qtdoc/build-sources.html
/usr/share/doc/qt/qtdoc/classes.html
/usr/share/doc/qt/qtdoc/classesandfunctions.html
/usr/share/doc/qt/qtdoc/cmake-command-reference.html
/usr/share/doc/qt/qtdoc/cmake-manual.html
/usr/share/doc/qt/qtdoc/cmake-variable-reference.html
/usr/share/doc/qt/qtdoc/commerciallicense.html
/usr/share/doc/qt/qtdoc/configure-linux-device.html
/usr/share/doc/qt/qtdoc/configure-options.html
/usr/share/doc/qt/qtdoc/debug.html
/usr/share/doc/qt/qtdoc/demos-manifest.xml
/usr/share/doc/qt/qtdoc/deployment-android.html
/usr/share/doc/qt/qtdoc/deployment-plugins.html
/usr/share/doc/qt/qtdoc/deployment.html
/usr/share/doc/qt/qtdoc/desktop-integration.html
/usr/share/doc/qt/qtdoc/embedded-linux.html
/usr/share/doc/qt/qtdoc/examples-activeqt.html
/usr/share/doc/qt/qtdoc/examples-android.html
/usr/share/doc/qt/qtdoc/examples-animation.html
/usr/share/doc/qt/qtdoc/examples-draganddrop.html
/usr/share/doc/qt/qtdoc/examples-gestures.html
/usr/share/doc/qt/qtdoc/examples-ios.html
/usr/share/doc/qt/qtdoc/examples-ipc.html
/usr/share/doc/qt/qtdoc/examples-layouts.html
/usr/share/doc/qt/qtdoc/examples-license.html
/usr/share/doc/qt/qtdoc/examples-manifest.xml
/usr/share/doc/qt/qtdoc/examples-sql.html
/usr/share/doc/qt/qtdoc/examples-statemachine.html
/usr/share/doc/qt/qtdoc/examples-threadandconcurrent.html
/usr/share/doc/qt/qtdoc/examples-widgets-tools.html
/usr/share/doc/qt/qtdoc/examples-xml.html
/usr/share/doc/qt/qtdoc/exceptionsafety.html
/usr/share/doc/qt/qtdoc/fdl.html
/usr/share/doc/qt/qtdoc/functions.html
/usr/share/doc/qt/qtdoc/gettingstarted.html
/usr/share/doc/qt/qtdoc/gpl.html
/usr/share/doc/qt/qtdoc/groups.html
/usr/share/doc/qt/qtdoc/hierarchy.html
/usr/share/doc/qt/qtdoc/highdpi.html
/usr/share/doc/qt/qtdoc/i18n-plural-rules.html
/usr/share/doc/qt/qtdoc/i18n-source-translation.html
/usr/share/doc/qt/qtdoc/i18n.html
/usr/share/doc/qt/qtdoc/index.html
/usr/share/doc/qt/qtdoc/integrity-building-monolith.html
/usr/share/doc/qt/qtdoc/integrity-building-qt-for-imx6quad-board.html
/usr/share/doc/qt/qtdoc/integrity-building-u-boot-image.html
/usr/share/doc/qt/qtdoc/integrity-creating-bootable-sd-card.html
/usr/share/doc/qt/qtdoc/integrity-installing-dependencies.html
/usr/share/doc/qt/qtdoc/integrity-monolith-project-tutorial.html
/usr/share/doc/qt/qtdoc/integrity-preparing-bsp-for-imx6quad-board.html
/usr/share/doc/qt/qtdoc/integrity-preparing-u-boot.html
/usr/share/doc/qt/qtdoc/integrity.html
/usr/share/doc/qt/qtdoc/internationalization.html
/usr/share/doc/qt/qtdoc/ios-building-from-source.html
/usr/share/doc/qt/qtdoc/ios-platform-notes.html
/usr/share/doc/qt/qtdoc/ios.html
/usr/share/doc/qt/qtdoc/ipc.html
/usr/share/doc/qt/qtdoc/known-issues.html
/usr/share/doc/qt/qtdoc/lgpl.html
/usr/share/doc/qt/qtdoc/license-changes.html
/usr/share/doc/qt/qtdoc/licenses-used-in-qt.html
/usr/share/doc/qt/qtdoc/licensing.html
/usr/share/doc/qt/qtdoc/linux-building.html
/usr/share/doc/qt/qtdoc/linux-deployment.html
/usr/share/doc/qt/qtdoc/linux-issues.html
/usr/share/doc/qt/qtdoc/linux-requirements.html
/usr/share/doc/qt/qtdoc/linux.html
/usr/share/doc/qt/qtdoc/macos-building.html
/usr/share/doc/qt/qtdoc/macos-deployment.html
/usr/share/doc/qt/qtdoc/macos-issues.html
/usr/share/doc/qt/qtdoc/macos.html
/usr/share/doc/qt/qtdoc/mobiledevelopment.html
/usr/share/doc/qt/qtdoc/moc.html
/usr/share/doc/qt/qtdoc/modules-cpp.html
/usr/share/doc/qt/qtdoc/modules-qml.html
/usr/share/doc/qt/qtdoc/modules.html
/usr/share/doc/qt/qtdoc/namespaces.html
/usr/share/doc/qt/qtdoc/newclasses51.html
/usr/share/doc/qt/qtdoc/newclasses510.html
/usr/share/doc/qt/qtdoc/newclasses511.html
/usr/share/doc/qt/qtdoc/newclasses512.html
/usr/share/doc/qt/qtdoc/newclasses513.html
/usr/share/doc/qt/qtdoc/newclasses52.html
/usr/share/doc/qt/qtdoc/newclasses53.html
/usr/share/doc/qt/qtdoc/newclasses54.html
/usr/share/doc/qt/qtdoc/newclasses55.html
/usr/share/doc/qt/qtdoc/newclasses56.html
/usr/share/doc/qt/qtdoc/newclasses57.html
/usr/share/doc/qt/qtdoc/newclasses58.html
/usr/share/doc/qt/qtdoc/newclasses59.html
/usr/share/doc/qt/qtdoc/obsoleteclasses.html
/usr/share/doc/qt/qtdoc/obsoleteqmltypes.html
/usr/share/doc/qt/qtdoc/opensourcelicense.html
/usr/share/doc/qt/qtdoc/overviews-main.html
/usr/share/doc/qt/qtdoc/overviews.html
/usr/share/doc/qt/qtdoc/plugins-howto.html
/usr/share/doc/qt/qtdoc/porting-to-android.html
/usr/share/doc/qt/qtdoc/porting-to-ios.html
/usr/share/doc/qt/qtdoc/portingcppapp.html
/usr/share/doc/qt/qtdoc/portingguide.html
/usr/share/doc/qt/qtdoc/portingqmlapp.html
/usr/share/doc/qt/qtdoc/qml-codingconventions.html
/usr/share/doc/qt/qtdoc/qml-glossary.html
/usr/share/doc/qt/qtdoc/qmlapplications.html
/usr/share/doc/qt/qtdoc/qmlbasictypes.html
/usr/share/doc/qt/qtdoc/qmlfirststeps.html
/usr/share/doc/qt/qtdoc/qmltypes.html
/usr/share/doc/qt/qtdoc/qnx.html
/usr/share/doc/qt/qtdoc/qpa.html
/usr/share/doc/qt/qtdoc/qt-activex.html
/usr/share/doc/qt/qtdoc/qt-attribution-cmake-macros.html
/usr/share/doc/qt/qtdoc/qt-attribution-llvm.html
/usr/share/doc/qt/qtdoc/qt-attribution-llvmpipe.html
/usr/share/doc/qt/qtdoc/qt-conf.html
/usr/share/doc/qt/qtdoc/qt-embedded-fonts.html
/usr/share/doc/qt/qtdoc/qt-embedded-kmap2qmap.html
/usr/share/doc/qt/qtdoc/qt-embedded-makeqpf.html
/usr/share/doc/qt/qtdoc/qt-gui-concepts.html
/usr/share/doc/qt/qtdoc/qt5-intro.html
/usr/share/doc/qt/qtdoc/qtconcurrent-mtexamples.html
/usr/share/doc/qt/qtdoc/qtconcurrentexamples.html
/usr/share/doc/qt/qtdoc/qtdoc-attribution-coffeeexample-titillium.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-calqlatr-calqlatr-pro.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-calqlatr-calqlatr-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-calqlatr-calqlatr-qmlproject.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-calqlatr-calqlatr-qrc.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-calqlatr-content-button-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-calqlatr-content-calculator-js.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-calqlatr-content-display-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-calqlatr-content-numberpad-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-calqlatr-example.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-calqlatr-main-cpp.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-clocks-clocks-pro.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-clocks-clocks-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-clocks-clocks-qmlproject.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-clocks-clocks-qrc.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-clocks-content-clock-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-clocks-example.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-clocks-main-cpp.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-applicationflow-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-applicationflowform-ui-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-brewing-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-brewingform-ui-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-choosingcoffee-ui-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-coffee-pro.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-coffeebutton-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-cup-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-cupform-ui-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-emptycup-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-emptycupform-ui-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-example.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-imports-coffee-constants-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-imports-coffee-qmldir.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-main-cpp.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-main-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-navigationbutton-ui-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-qml-qrc.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-sidebar-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-coffee-sidebarform-ui-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-buildbutton-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-gamecanvas-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-gameoverscreen-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-infobar-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-logic-js.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-mobs-mobbase-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-newgamescreen-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-soundeffect-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-towers-bomb-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-towers-factory-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-towers-melee-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-towers-ranged-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-content-towers-towerbase-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-example.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-main-cpp.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-maroon-pro.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-maroon-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-maroon-qmlproject.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-maroon-maroon-qrc.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-photosurface-example.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-photosurface-main-cpp.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-photosurface-photosurface-pro.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-photosurface-photosurface-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-photosurface-photosurface-qmlproject.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-photosurface-photosurface-qrc.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-photoviewer-example.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-photoviewer-main-cpp.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-photoviewer-main-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-photoviewer-photoviewer-pro.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-photoviewer-photoviewercore-albumdelegate-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-photoviewer-photoviewercore-busyindicator-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-photoviewer-photoviewercore-button-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-photoviewer-photoviewercore-editablebutton-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-photoviewer-photoviewercore-photodelegate-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-photoviewer-photoviewercore-progressbar-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-photoviewer-photoviewercore-rssmodel-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-photoviewer-photoviewercore-tag-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-rssnews-content-busyindicator-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-rssnews-content-categorydelegate-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-rssnews-content-newsdelegate-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-rssnews-content-rssfeeds-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-rssnews-content-scrollbar-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-rssnews-example.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-rssnews-main-cpp.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-rssnews-rssnews-pro.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-rssnews-rssnews-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-rssnews-rssnews-qmlproject.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-rssnews-rssnews-qrc.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-block-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-blockemitter-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-button-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-gamearea-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-levels-level0-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-levels-level1-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-levels-level2-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-levels-level3-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-levels-level4-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-levels-level5-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-levels-level6-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-levels-level7-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-levels-level8-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-levels-level9-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-levels-templatebase-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-logoanimation-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-menuemitter-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-paintemitter-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-primarypack-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-puzzleblock-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-qmldir.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-samegame-js.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-samegametext-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-settings-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-simpleblock-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-content-smoketext-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-example.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-main-cpp.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-samegame-pro.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-samegame-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-samegame-qmlproject.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-samegame-samegame-qrc.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-banner-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-button-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-checkbox-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-qmldir.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-settings-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-stockchart-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-stockinfo-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-stocklistdelegate-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-stocklistmodel-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-stocklistview-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-stockmodel-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-stocksettingspanel-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-stockview-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-content-windows-settings-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-example.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-main-cpp.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-stocqt-pro.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-stocqt-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-stocqt-qmlproject.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-stocqt-stocqt-qrc.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-tweetsearch-content-flipbar-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-tweetsearch-content-lineinput-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-tweetsearch-content-listfooter-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-tweetsearch-content-listheader-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-tweetsearch-content-searchdelegate-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-tweetsearch-content-tweetdelegate-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-tweetsearch-content-tweetsmodel-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-tweetsearch-example.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-tweetsearch-main-cpp.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-tweetsearch-tweetsearch-pro.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-tweetsearch-tweetsearch-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-demos-tweetsearch-tweetsearch-qmlproject.html
/usr/share/doc/qt/qtdoc/qtdoc-tutorials-alarms-alarmdelegate-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-tutorials-alarms-alarmdialog-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-tutorials-alarms-alarmmodel-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-tutorials-alarms-alarms-pro.html
/usr/share/doc/qt/qtdoc/qtdoc-tutorials-alarms-example.html
/usr/share/doc/qt/qtdoc/qtdoc-tutorials-alarms-main-cpp.html
/usr/share/doc/qt/qtdoc/qtdoc-tutorials-alarms-main-qml.html
/usr/share/doc/qt/qtdoc/qtdoc-tutorials-alarms-qml-qrc.html
/usr/share/doc/qt/qtdoc/qtdoc-tutorials-alarms-tumblerdelegate-qml.html
/usr/share/doc/qt/qtdoc/qtdoc.index
/usr/share/doc/qt/qtdoc/qtdoc.qhp
/usr/share/doc/qt/qtdoc/qtdoc.qhp.sha1
/usr/share/doc/qt/qtdoc/qtexamples.html
/usr/share/doc/qt/qtdoc/qtexamplesandtutorials.html
/usr/share/doc/qt/qtdoc/qtmain.html
/usr/share/doc/qt/qtdoc/qtmodules.html
/usr/share/doc/qt/qtdoc/qtopenglextensions.html
/usr/share/doc/qt/qtdoc/qtquick-debugging.html
/usr/share/doc/qt/qtdoc/qtquick-deployment.html
/usr/share/doc/qt/qtdoc/qtquick-internationalization.html
/usr/share/doc/qt/qtdoc/qtquick-performance.html
/usr/share/doc/qt/qtdoc/qtquick-porting-qt5.html
/usr/share/doc/qt/qtdoc/qtquick-qmlscene.html
/usr/share/doc/qt/qtdoc/qtquick-usecase-animations.html
/usr/share/doc/qt/qtdoc/qtquick-usecase-integratingjs.html
/usr/share/doc/qt/qtdoc/qtquick-usecase-layouts.html
/usr/share/doc/qt/qtdoc/qtquick-usecase-styling.html
/usr/share/doc/qt/qtdoc/qtquick-usecase-text.html
/usr/share/doc/qt/qtdoc/qtquick-usecase-userinput.html
/usr/share/doc/qt/qtdoc/qtquick-usecase-visual.html
/usr/share/doc/qt/qtdoc/qtquickcontrols-texteditor-action.html
/usr/share/doc/qt/qtdoc/qtquickcontrols-texteditor-logic.html
/usr/share/doc/qt/qtdoc/qtquickcontrols-texteditor-ui.html
/usr/share/doc/qt/qtdoc/qtquickcontrols-texteditor.html
/usr/share/doc/qt/qtdoc/qtwebassembly-platform-notes.html
/usr/share/doc/qt/qtdoc/qundo.html
/usr/share/doc/qt/qtdoc/rcc.html
/usr/share/doc/qt/qtdoc/reference-overview.html
/usr/share/doc/qt/qtdoc/restoring-geometry.html
/usr/share/doc/qt/qtdoc/scalability.html
/usr/share/doc/qt/qtdoc/session.html
/usr/share/doc/qt/qtdoc/sharedlibrary.html
/usr/share/doc/qt/qtdoc/signalsandslots-syntaxes.html
/usr/share/doc/qt/qtdoc/sourcebreaks.html
/usr/share/doc/qt/qtdoc/sql-examples.html
/usr/share/doc/qt/qtdoc/string-processing.html
/usr/share/doc/qt/qtdoc/supported-platforms.html
/usr/share/doc/qt/qtdoc/testing-and-debugging.html
/usr/share/doc/qt/qtdoc/third-party-libraries.html
/usr/share/doc/qt/qtdoc/thread-basics.html
/usr/share/doc/qt/qtdoc/thread.html
/usr/share/doc/qt/qtdoc/threads-modules.html
/usr/share/doc/qt/qtdoc/threads-qobject.html
/usr/share/doc/qt/qtdoc/threads-reentrancy.html
/usr/share/doc/qt/qtdoc/threads-synchronizing.html
/usr/share/doc/qt/qtdoc/threads-technologies.html
/usr/share/doc/qt/qtdoc/threads.html
/usr/share/doc/qt/qtdoc/topics-app-development.html
/usr/share/doc/qt/qtdoc/topics-core.html
/usr/share/doc/qt/qtdoc/topics-data-storage.html
/usr/share/doc/qt/qtdoc/topics-graphics.html
/usr/share/doc/qt/qtdoc/topics-network-connectivity.html
/usr/share/doc/qt/qtdoc/topics-scripting.html
/usr/share/doc/qt/qtdoc/topics-ui.html
/usr/share/doc/qt/qtdoc/topics-web-content.html
/usr/share/doc/qt/qtdoc/touchinputexamples.html
/usr/share/doc/qt/qtdoc/trademarks.html
/usr/share/doc/qt/qtdoc/uic.html
/usr/share/doc/qt/qtdoc/unicode.html
/usr/share/doc/qt/qtdoc/unix-signals.html
/usr/share/doc/qt/qtdoc/vxworks.html
/usr/share/doc/qt/qtdoc/wasm.html
/usr/share/doc/qt/qtdoc/wayland-and-qt.html
/usr/share/doc/qt/qtdoc/webgl.html
/usr/share/doc/qt/qtdoc/whatsnew50.html
/usr/share/doc/qt/qtdoc/whatsnew51.html
/usr/share/doc/qt/qtdoc/whatsnew510.html
/usr/share/doc/qt/qtdoc/whatsnew511.html
/usr/share/doc/qt/qtdoc/whatsnew512.html
/usr/share/doc/qt/qtdoc/whatsnew513.html
/usr/share/doc/qt/qtdoc/whatsnew52.html
/usr/share/doc/qt/qtdoc/whatsnew53.html
/usr/share/doc/qt/qtdoc/whatsnew54.html
/usr/share/doc/qt/qtdoc/whatsnew55.html
/usr/share/doc/qt/qtdoc/whatsnew56.html
/usr/share/doc/qt/qtdoc/whatsnew57.html
/usr/share/doc/qt/qtdoc/whatsnew58.html
/usr/share/doc/qt/qtdoc/whatsnew59.html
/usr/share/doc/qt/qtdoc/why-moc.html
/usr/share/doc/qt/qtdoc/windows-building.html
/usr/share/doc/qt/qtdoc/windows-deployment.html
/usr/share/doc/qt/qtdoc/windows-issues.html
/usr/share/doc/qt/qtdoc/windows-requirements.html
/usr/share/doc/qt/qtdoc/windows.html
/usr/share/doc/qt/qtdoc/winrt-support.html
/usr/share/doc/qt/qtdoc/xml-examples.html
/usr/share/doc/qt/qtdoc/images/I5jasWrsxT0.jpg
/usr/share/doc/qt/qtdoc/images/accessibleobjecttree.png
/usr/share/doc/qt/qtdoc/images/activeqt-examples.png
/usr/share/doc/qt/qtdoc/images/addalarms.png
/usr/share/doc/qt/qtdoc/images/alarms2.png
/usr/share/doc/qt/qtdoc/images/alarms3.png
/usr/share/doc/qt/qtdoc/images/animatedtiles_snapshot.png
/usr/share/doc/qt/qtdoc/images/animation-examples.png
/usr/share/doc/qt/qtdoc/images/applicationwindow.png
/usr/share/doc/qt/qtdoc/images/arrow_bc.png
/usr/share/doc/qt/qtdoc/images/bgrContent.png
/usr/share/doc/qt/qtdoc/images/btn_next.png
/usr/share/doc/qt/qtdoc/images/btn_prev.png
/usr/share/doc/qt/qtdoc/images/bullet_dn.png
/usr/share/doc/qt/qtdoc/images/bullet_sq.png
/usr/share/doc/qt/qtdoc/images/coffee_machine_emptycup.png
/usr/share/doc/qt/qtdoc/images/coffee_machine_modify.png
/usr/share/doc/qt/qtdoc/images/coffee_machine_overview.png
/usr/share/doc/qt/qtdoc/images/coffee_machine_selection.png
/usr/share/doc/qt/qtdoc/images/controlstexteditor_designer.png
/usr/share/doc/qt/qtdoc/images/controlstexteditor_main.png
/usr/share/doc/qt/qtdoc/images/controlstexteditor_navigator.png
/usr/share/doc/qt/qtdoc/images/controlstexteditor_newproperties.png
/usr/share/doc/qt/qtdoc/images/controlstexteditor_openproperties.png
/usr/share/doc/qt/qtdoc/images/controlstexteditor_rowproperties.png
/usr/share/doc/qt/qtdoc/images/deployment-mac-application.png
/usr/share/doc/qt/qtdoc/images/deployment-mac-bundlestructure.png
/usr/share/doc/qt/qtdoc/images/deployment-windows-depends.png
/usr/share/doc/qt/qtdoc/images/detailscreen.png
/usr/share/doc/qt/qtdoc/images/draganddrop-examples.png
/usr/share/doc/qt/qtdoc/images/flickr_application.png
/usr/share/doc/qt/qtdoc/images/home.png
/usr/share/doc/qt/qtdoc/images/ico_note.png
/usr/share/doc/qt/qtdoc/images/ico_note_attention.png
/usr/share/doc/qt/qtdoc/images/ico_out.png
/usr/share/doc/qt/qtdoc/images/icon_QtCreator_78x78px.png
/usr/share/doc/qt/qtdoc/images/icon_Qt_78x78px.png
/usr/share/doc/qt/qtdoc/images/icon_Tools.png
/usr/share/doc/qt/qtdoc/images/kernel-settings.png
/usr/share/doc/qt/qtdoc/images/layout-examples.png
/usr/share/doc/qt/qtdoc/images/logo.png
/usr/share/doc/qt/qtdoc/images/mainscreen.png
/usr/share/doc/qt/qtdoc/images/mob-idle.png
/usr/share/doc/qt/qtdoc/images/ok.png
/usr/share/doc/qt/qtdoc/images/open-project.png
/usr/share/doc/qt/qtdoc/images/project-view-2.png
/usr/share/doc/qt/qtdoc/images/project-view.png
/usr/share/doc/qt/qtdoc/images/project-wizard.png
/usr/share/doc/qt/qtdoc/images/qml-extending-types.gif
/usr/share/doc/qt/qtdoc/images/qml-uses-animation.png
/usr/share/doc/qt/qtdoc/images/qml-uses-integratingjs.png
/usr/share/doc/qt/qtdoc/images/qml-uses-layouts-anchors.png
/usr/share/doc/qt/qtdoc/images/qml-uses-layouts-direct.png
/usr/share/doc/qt/qtdoc/images/qml-uses-layouts-positioners.png
/usr/share/doc/qt/qtdoc/images/qml-uses-text.png
/usr/share/doc/qt/qtdoc/images/qml-uses-visual-opacity.png
/usr/share/doc/qt/qtdoc/images/qml-uses-visual-rectangles.png
/usr/share/doc/qt/qtdoc/images/qml-uses-visual-transforms.png
/usr/share/doc/qt/qtdoc/images/qt-codesample.png
/usr/share/doc/qt/qtdoc/images/qt-creator-gs.png
/usr/share/doc/qt/qtdoc/images/qt-embedded-fontfeatures.png
/usr/share/doc/qt/qtdoc/images/qt5_everywhere_demo.jpg
/usr/share/doc/qt/qtdoc/images/qt5_graphicaleffects.jpg
/usr/share/doc/qt/qtdoc/images/qt5_particles.jpg
/usr/share/doc/qt/qtdoc/images/qt5_shadereffect.jpg
/usr/share/doc/qt/qtdoc/images/qt5_video.jpg
/usr/share/doc/qt/qtdoc/images/qt5_widgets.jpg
/usr/share/doc/qt/qtdoc/images/qtcreator-run.png
/usr/share/doc/qt/qtdoc/images/qtlocation-mapviewer-demo.jpg
/usr/share/doc/qt/qtdoc/images/qtpositioning_weatherinfo_ex.jpg
/usr/share/doc/qt/qtdoc/images/qtquick-demo-calqlatr.png
/usr/share/doc/qt/qtdoc/images/qtquick-demo-clocks-small.png
/usr/share/doc/qt/qtdoc/images/qtquick-demo-maroon-med-1.png
/usr/share/doc/qt/qtdoc/images/qtquick-demo-maroon-med-2.png
/usr/share/doc/qt/qtdoc/images/qtquick-demo-maroon-med-3.jpg
/usr/share/doc/qt/qtdoc/images/qtquick-demo-maroon-med-4.jpg
/usr/share/doc/qt/qtdoc/images/qtquick-demo-maroon-med-5.jpg
/usr/share/doc/qt/qtdoc/images/qtquick-demo-maroon-med-6.jpg
/usr/share/doc/qt/qtdoc/images/qtquick-demo-photosurface-small.png
/usr/share/doc/qt/qtdoc/images/qtquick-demo-photoviewer-small.png
/usr/share/doc/qt/qtdoc/images/qtquick-demo-rssnews-small.png
/usr/share/doc/qt/qtdoc/images/qtquick-demo-samegame-med-1.png
/usr/share/doc/qt/qtdoc/images/qtquick-demo-samegame-med-2.png
/usr/share/doc/qt/qtdoc/images/qtquick-demo-stocqt.png
/usr/share/doc/qt/qtdoc/images/qtquick-demo-tweetsearch-med-1.png
/usr/share/doc/qt/qtdoc/images/qtquick-demo-tweetsearch-med-2.png
/usr/share/doc/qt/qtdoc/images/qtquickcontrols2-material.png
/usr/share/doc/qt/qtdoc/images/qtsensors_accelbubble_ex.jpg
/usr/share/doc/qt/qtdoc/images/qtwebengine_quicknanobrowser.jpg
/usr/share/doc/qt/qtdoc/images/scalability-gridlayout.png
/usr/share/doc/qt/qtdoc/images/select-item-to-add.png
/usr/share/doc/qt/qtdoc/images/session.png
/usr/share/doc/qt/qtdoc/images/sql-examples.png
/usr/share/doc/qt/qtdoc/images/thread-examples.png
/usr/share/doc/qt/qtdoc/images/threadsandobjects.png
/usr/share/doc/qt/qtdoc/images/threadvisual-example.png
/usr/share/doc/qt/qtdoc/images/tool-examples.png
/usr/share/doc/qt/qtdoc/images/wayland-multi-process.png
/usr/share/doc/qt/qtdoc/images/wayland-single-process-develop.png
/usr/share/doc/qt/qtdoc/images/wayland-single-process-eglfs.png
/usr/share/doc/qt/qtdoc/images/xml-examples.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/calqlatr/
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/calqlatr/content/
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/calqlatr/content/images/paper-edge-left.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/calqlatr/content/images/paper-edge-right.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/calqlatr/content/images/paper-grip.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/clocks/
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/clocks/content/arrow.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/clocks/content/background.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/clocks/content/center.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/clocks/content/clock-night.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/clocks/content/clock.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/clocks/content/hour.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/clocks/content/minute.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/clocks/content/quit.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/clocks/content/second.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/coffee_cup_large.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/coffee_cup_outline.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/cup elements/coffee_cup_back.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/cup elements/coffee_cup_coverplate.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/cup elements/coffee_cup_front.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/liquids/liquid_coffee.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/liquids/liquid_foam.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/cup structure/liquids/liquid_milk.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/icons/
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/icons/coffees/Americano.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/icons/coffees/Espresso.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/icons/coffees/Latte.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/icons/coffees/Macchiato.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/icons/coffees/cappucino.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/icons/contents/coffee.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/icons/contents/milk.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/icons/contents/sugar.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/ui controls/line.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/ui controls/buttons/
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/ui controls/buttons/back/white.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/coffee/images/ui controls/buttons/go/white.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/background.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/bomb-action.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/bomb-idle.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/bomb.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/button-help.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/button-play.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/catch-action.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/catch.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/cloud.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/currency.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/dialog-bomb.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/dialog-factory.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/dialog-melee.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/dialog-pointer.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/dialog-shooter.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/dialog.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/factory-action.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/factory-idle.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/factory.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/grid.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/help.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/lifes.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/logo-bubble.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/logo-fish.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/logo.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/melee-action.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/melee-idle.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/melee.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/mob-idle.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/mob.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/points.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/projectile-action.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/projectile.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/scores.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/shooter-action.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/shooter-idle.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/shooter.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/sunlight.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/text-1.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/text-2.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/text-3.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/text-blank.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/text-gameover.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/text-go.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/maroon/content/gfx/wave.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/photosurface/
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/photosurface/resources/folder.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/photosurface/resources/icon.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/photoviewer/
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/photoviewer/PhotoViewerCore/
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/photoviewer/PhotoViewerCore/images/box-shadow.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/photoviewer/PhotoViewerCore/images/busy.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/photoviewer/PhotoViewerCore/images/cardboard.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/Asia.jpg
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/Business.jpg
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/Entertainment.jpg
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/Europe.jpg
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/Health.jpg
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/Politics.jpg
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/Science.jpg
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/Sports.jpg
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/Technology.jpg
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/TopStories.jpg
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/USNational.jpg
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/World.jpg
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/btn_close.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/busy.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/rssnews/content/images/scrollbar.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/background-puzzle.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/background.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/bar.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/blue-puzzle.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/blue.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/bubble-highscore.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/bubble-puzzle.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/but-game-1.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/but-game-2.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/but-game-3.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/but-game-4.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/but-game-new.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/but-menu.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/but-puzzle-next.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/but-quit.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/green-puzzle.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/green.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/icon-fail.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/icon-ok.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/icon-time.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/logo-a.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/logo-e.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/logo-g.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/logo-m.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/logo-s.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/logo.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/particle-brick.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/particle-paint.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/particle-smoke.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/red-puzzle.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/red.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-highscore-new.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-highscore.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-no-winner.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-p1-go.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-p1-won.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-p1.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-p2-go.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-p2-won.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/text-p2.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/yellow-puzzle.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/samegame/content/gfx/yellow.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/stocqt/
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/stocqt/content/
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/stocqt/content/images/icon-left-arrow.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/stocqt/content/images/wheel-touch.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/stocqt/content/images/wheel.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/tweetsearch/
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/tweetsearch/content/
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/tweetsearch/content/resources/anonymous.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/tweetsearch/content/resources/bird-anim-sprites.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/tweetsearch/content/resources/icon-clear.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/tweetsearch/content/resources/icon-loading.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/tweetsearch/content/resources/icon-refresh.png
/usr/share/doc/qt/qtdoc/images/used-in-examples/demos/tweetsearch/content/resources/icon-search.png
/usr/share/doc/qt/qtdoc/style/offline-simple.css
/usr/share/doc/qt/qtdoc/style/offline.css
/usr/share/doc/qt/qtdoc/style/qt5-sidebar.html
/usr/share/doc/qt/qtgamepad/examples-manifest.xml
/usr/share/doc/qt/qtgamepad/qgamepad-members.html
/usr/share/doc/qt/qtgamepad/qgamepad.html
/usr/share/doc/qt/qtgamepad/qgamepadkeynavigation-members.html
/usr/share/doc/qt/qtgamepad/qgamepadkeynavigation.html
/usr/share/doc/qt/qtgamepad/qgamepadmanager-members.html
/usr/share/doc/qt/qtgamepad/qgamepadmanager.html
/usr/share/doc/qt/qtgamepad/qml-qtgamepad-gamepad-members.html
/usr/share/doc/qt/qtgamepad/qml-qtgamepad-gamepad.html
/usr/share/doc/qt/qtgamepad/qml-qtgamepad-gamepadmanager-members.html
/usr/share/doc/qt/qtgamepad/qml-qtgamepad-gamepadmanager.html
/usr/share/doc/qt/qtgamepad/qtgamepad-configurebuttons-example.html
/usr/share/doc/qt/qtgamepad/qtgamepad-examples.html
/usr/share/doc/qt/qtgamepad/qtgamepad-index.html
/usr/share/doc/qt/qtgamepad/qtgamepad-keynavigation-example.html
/usr/share/doc/qt/qtgamepad/qtgamepad-module.html
/usr/share/doc/qt/qtgamepad/qtgamepad-mouseitem-example.html
/usr/share/doc/qt/qtgamepad/qtgamepad-qmlmodule.html
/usr/share/doc/qt/qtgamepad/qtgamepad-quickgamepad-example.html
/usr/share/doc/qt/qtgamepad/qtgamepad-simple-example.html
/usr/share/doc/qt/qtgamepad/qtgamepad.index
/usr/share/doc/qt/qtgamepad/qtgamepad.qhp
/usr/share/doc/qt/qtgamepad/qtgamepad.qhp.sha1
/usr/share/doc/qt/qtgamepad/images/arrow_bc.png
/usr/share/doc/qt/qtgamepad/images/bgrContent.png
/usr/share/doc/qt/qtgamepad/images/btn_next.png
/usr/share/doc/qt/qtgamepad/images/btn_prev.png
/usr/share/doc/qt/qtgamepad/images/bullet_dn.png
/usr/share/doc/qt/qtgamepad/images/bullet_sq.png
/usr/share/doc/qt/qtgamepad/images/configuregamepadbuttons-example.png
/usr/share/doc/qt/qtgamepad/images/home.png
/usr/share/doc/qt/qtgamepad/images/ico_note.png
/usr/share/doc/qt/qtgamepad/images/ico_note_attention.png
/usr/share/doc/qt/qtgamepad/images/ico_out.png
/usr/share/doc/qt/qtgamepad/images/keynavigationgamepad-example.png
/usr/share/doc/qt/qtgamepad/images/logo.png
/usr/share/doc/qt/qtgamepad/images/qtquickgamepad-example.png
/usr/share/doc/qt/qtgamepad/style/offline-simple.css
/usr/share/doc/qt/qtgamepad/style/offline.css
/usr/share/doc/qt/qtgraphicaleffects/graphicaleffects.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-blend-members.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-blend.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-brightnesscontrast-members.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-brightnesscontrast.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-colorize-members.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-colorize.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-coloroverlay-members.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-coloroverlay.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-conicalgradient-members.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-conicalgradient.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-desaturate-members.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-desaturate.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-directionalblur-members.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-directionalblur.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-displace-members.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-displace.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-dropshadow-members.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-dropshadow.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-fastblur-members.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-fastblur.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-gammaadjust-members.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-gammaadjust.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-gaussianblur-members.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-gaussianblur.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-glow-members.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-glow.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-huesaturation-members.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-huesaturation.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-innershadow-members.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-innershadow.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-leveladjust-members.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-leveladjust.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-lineargradient-members.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-lineargradient.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-maskedblur-members.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-maskedblur.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-opacitymask-members.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-opacitymask.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-radialblur-members.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-radialblur.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-radialgradient-members.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-radialgradient.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-rectangularglow-members.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-rectangularglow.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-recursiveblur-members.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-recursiveblur.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-thresholdmask-members.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-thresholdmask.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-zoomblur-members.html
/usr/share/doc/qt/qtgraphicaleffects/qml-qtgraphicaleffects-zoomblur.html
/usr/share/doc/qt/qtgraphicaleffects/qtgraphicaleffects-index.html
/usr/share/doc/qt/qtgraphicaleffects/qtgraphicaleffects-qmlmodule.html
/usr/share/doc/qt/qtgraphicaleffects/qtgraphicaleffects.index
/usr/share/doc/qt/qtgraphicaleffects/qtgraphicaleffects.qhp
/usr/share/doc/qt/qtgraphicaleffects/qtgraphicaleffects.qhp.sha1
/usr/share/doc/qt/qtgraphicaleffects/qtgraphicaleffects.tags
/usr/share/doc/qt/qtgraphicaleffects/images/Blend_bug_and_butterfly.png
/usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode1.png
/usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode10.png
/usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode11.png
/usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode12.png
/usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode13.png
/usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode14.png
/usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode15.png
/usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode16.png
/usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode17.png
/usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode18.png
/usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode19.png
/usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode2.png
/usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode20.png
/usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode21.png
/usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode22.png
/usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode3.png
/usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode4.png
/usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode5.png
/usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode6.png
/usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode7.png
/usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode8.png
/usr/share/doc/qt/qtgraphicaleffects/images/Blend_mode9.png
/usr/share/doc/qt/qtgraphicaleffects/images/BrightnessContrast_brightness1.png
/usr/share/doc/qt/qtgraphicaleffects/images/BrightnessContrast_brightness2.png
/usr/share/doc/qt/qtgraphicaleffects/images/BrightnessContrast_brightness3.png
/usr/share/doc/qt/qtgraphicaleffects/images/BrightnessContrast_bug.png
/usr/share/doc/qt/qtgraphicaleffects/images/BrightnessContrast_contrast1.png
/usr/share/doc/qt/qtgraphicaleffects/images/BrightnessContrast_contrast2.png
/usr/share/doc/qt/qtgraphicaleffects/images/BrightnessContrast_contrast3.png
/usr/share/doc/qt/qtgraphicaleffects/images/BrightnessContrast_contrast_graph.png
/usr/share/doc/qt/qtgraphicaleffects/images/ColorOverlay_butterfly.png
/usr/share/doc/qt/qtgraphicaleffects/images/ColorOverlay_color1.png
/usr/share/doc/qt/qtgraphicaleffects/images/ColorOverlay_color2.png
/usr/share/doc/qt/qtgraphicaleffects/images/ColorOverlay_color3.png
/usr/share/doc/qt/qtgraphicaleffects/images/Colorize_bug.png
/usr/share/doc/qt/qtgraphicaleffects/images/Colorize_hue1.png
/usr/share/doc/qt/qtgraphicaleffects/images/Colorize_hue2.png
/usr/share/doc/qt/qtgraphicaleffects/images/Colorize_hue3.png
/usr/share/doc/qt/qtgraphicaleffects/images/Colorize_hue_scale.png
/usr/share/doc/qt/qtgraphicaleffects/images/Colorize_lightness1.png
/usr/share/doc/qt/qtgraphicaleffects/images/Colorize_lightness2.png
/usr/share/doc/qt/qtgraphicaleffects/images/Colorize_lightness3.png
/usr/share/doc/qt/qtgraphicaleffects/images/Colorize_saturation1.png
/usr/share/doc/qt/qtgraphicaleffects/images/Colorize_saturation2.png
/usr/share/doc/qt/qtgraphicaleffects/images/Colorize_saturation3.png
/usr/share/doc/qt/qtgraphicaleffects/images/ConicalGradient.png
/usr/share/doc/qt/qtgraphicaleffects/images/ConicalGradient_angle1.png
/usr/share/doc/qt/qtgraphicaleffects/images/ConicalGradient_angle2.png
/usr/share/doc/qt/qtgraphicaleffects/images/ConicalGradient_angle3.png
/usr/share/doc/qt/qtgraphicaleffects/images/ConicalGradient_gradient1.png
/usr/share/doc/qt/qtgraphicaleffects/images/ConicalGradient_gradient2.png
/usr/share/doc/qt/qtgraphicaleffects/images/ConicalGradient_gradient3.png
/usr/share/doc/qt/qtgraphicaleffects/images/ConicalGradient_horizontalOffset1.png
/usr/share/doc/qt/qtgraphicaleffects/images/ConicalGradient_horizontalOffset2.png
/usr/share/doc/qt/qtgraphicaleffects/images/ConicalGradient_horizontalOffset3.png
/usr/share/doc/qt/qtgraphicaleffects/images/ConicalGradient_maskSource1.png
/usr/share/doc/qt/qtgraphicaleffects/images/ConicalGradient_maskSource2.png
/usr/share/doc/qt/qtgraphicaleffects/images/Desaturate_bug.png
/usr/share/doc/qt/qtgraphicaleffects/images/Desaturate_desaturation1.png
/usr/share/doc/qt/qtgraphicaleffects/images/Desaturate_desaturation2.png
/usr/share/doc/qt/qtgraphicaleffects/images/Desaturate_desaturation3.png
/usr/share/doc/qt/qtgraphicaleffects/images/DirectionalBlur_angle1.png
/usr/share/doc/qt/qtgraphicaleffects/images/DirectionalBlur_angle2.png
/usr/share/doc/qt/qtgraphicaleffects/images/DirectionalBlur_angle3.png
/usr/share/doc/qt/qtgraphicaleffects/images/DirectionalBlur_bug.png
/usr/share/doc/qt/qtgraphicaleffects/images/DirectionalBlur_length1.png
/usr/share/doc/qt/qtgraphicaleffects/images/DirectionalBlur_length2.png
/usr/share/doc/qt/qtgraphicaleffects/images/DirectionalBlur_length3.png
/usr/share/doc/qt/qtgraphicaleffects/images/Displace_bug.png
/usr/share/doc/qt/qtgraphicaleffects/images/Displace_displacement1.png
/usr/share/doc/qt/qtgraphicaleffects/images/Displace_displacement2.png
/usr/share/doc/qt/qtgraphicaleffects/images/Displace_displacement3.png
/usr/share/doc/qt/qtgraphicaleffects/images/Displace_map.png
/usr/share/doc/qt/qtgraphicaleffects/images/DropShadow-transparentBorder.png
/usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_butterfly.png
/usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_color1.png
/usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_color2.png
/usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_color3.png
/usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_horizontalOffset1.png
/usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_horizontalOffset2.png
/usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_horizontalOffset3.png
/usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_radius1.png
/usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_radius2.png
/usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_radius3.png
/usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_spread1.png
/usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_spread2.png
/usr/share/doc/qt/qtgraphicaleffects/images/DropShadow_spread3.png
/usr/share/doc/qt/qtgraphicaleffects/images/FastBlur_bug.png
/usr/share/doc/qt/qtgraphicaleffects/images/FastBlur_radius1.png
/usr/share/doc/qt/qtgraphicaleffects/images/FastBlur_radius2.png
/usr/share/doc/qt/qtgraphicaleffects/images/FastBlur_radius3.png
/usr/share/doc/qt/qtgraphicaleffects/images/FastBlur_transparentBorder1.png
/usr/share/doc/qt/qtgraphicaleffects/images/FastBlur_transparentBorder2.png
/usr/share/doc/qt/qtgraphicaleffects/images/GammaAdjust_bug.png
/usr/share/doc/qt/qtgraphicaleffects/images/GammaAdjust_gamma1.png
/usr/share/doc/qt/qtgraphicaleffects/images/GammaAdjust_gamma1_graph.png
/usr/share/doc/qt/qtgraphicaleffects/images/GammaAdjust_gamma2.png
/usr/share/doc/qt/qtgraphicaleffects/images/GammaAdjust_gamma2_graph.png
/usr/share/doc/qt/qtgraphicaleffects/images/GammaAdjust_gamma3.png
/usr/share/doc/qt/qtgraphicaleffects/images/GammaAdjust_gamma3_graph.png
/usr/share/doc/qt/qtgraphicaleffects/images/GaussianBlur_bug.png
/usr/share/doc/qt/qtgraphicaleffects/images/GaussianBlur_deviation1.png
/usr/share/doc/qt/qtgraphicaleffects/images/GaussianBlur_deviation2.png
/usr/share/doc/qt/qtgraphicaleffects/images/GaussianBlur_deviation3.png
/usr/share/doc/qt/qtgraphicaleffects/images/GaussianBlur_deviation_graph.png
/usr/share/doc/qt/qtgraphicaleffects/images/GaussianBlur_radius1.png
/usr/share/doc/qt/qtgraphicaleffects/images/GaussianBlur_radius2.png
/usr/share/doc/qt/qtgraphicaleffects/images/GaussianBlur_radius3.png
/usr/share/doc/qt/qtgraphicaleffects/images/GaussianBlur_transparentBorder1.png
/usr/share/doc/qt/qtgraphicaleffects/images/GaussianBlur_transparentBorder2.png
/usr/share/doc/qt/qtgraphicaleffects/images/Glow-transparentBorder.png
/usr/share/doc/qt/qtgraphicaleffects/images/Glow_butterfly.png
/usr/share/doc/qt/qtgraphicaleffects/images/Glow_color1.png
/usr/share/doc/qt/qtgraphicaleffects/images/Glow_color2.png
/usr/share/doc/qt/qtgraphicaleffects/images/Glow_color3.png
/usr/share/doc/qt/qtgraphicaleffects/images/Glow_radius1.png
/usr/share/doc/qt/qtgraphicaleffects/images/Glow_radius2.png
/usr/share/doc/qt/qtgraphicaleffects/images/Glow_radius3.png
/usr/share/doc/qt/qtgraphicaleffects/images/Glow_spread1.png
/usr/share/doc/qt/qtgraphicaleffects/images/Glow_spread2.png
/usr/share/doc/qt/qtgraphicaleffects/images/Glow_spread3.png
/usr/share/doc/qt/qtgraphicaleffects/images/HueSaturation_bug.png
/usr/share/doc/qt/qtgraphicaleffects/images/HueSaturation_hue1.png
/usr/share/doc/qt/qtgraphicaleffects/images/HueSaturation_hue2.png
/usr/share/doc/qt/qtgraphicaleffects/images/HueSaturation_hue3.png
/usr/share/doc/qt/qtgraphicaleffects/images/HueSaturation_lightness1.png
/usr/share/doc/qt/qtgraphicaleffects/images/HueSaturation_lightness2.png
/usr/share/doc/qt/qtgraphicaleffects/images/HueSaturation_lightness3.png
/usr/share/doc/qt/qtgraphicaleffects/images/HueSaturation_saturation1.png
/usr/share/doc/qt/qtgraphicaleffects/images/HueSaturation_saturation2.png
/usr/share/doc/qt/qtgraphicaleffects/images/HueSaturation_saturation3.png
/usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_butterfly.png
/usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_color1.png
/usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_color2.png
/usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_color3.png
/usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_fast1.png
/usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_fast2.png
/usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_horizontalOffset1.png
/usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_horizontalOffset2.png
/usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_horizontalOffset3.png
/usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_radius1.png
/usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_radius2.png
/usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_radius3.png
/usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_spread1.png
/usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_spread2.png
/usr/share/doc/qt/qtgraphicaleffects/images/InnerShadow_spread3.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_butterfly.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_default_curve.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_gamma1.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_gamma2.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_gamma2_curve.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_gamma3.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_gamma3_curve.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_maximumInput1.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_maximumInput2.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_maximumInput2_curve.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_maximumInput3.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_maximumInput3_curve.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_maximumOutput1.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_maximumOutput2.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_maximumOutput2_curve.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_maximumOutput3.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_maximumOutput3_curve.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_minimumInput1.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_minimumInput2.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_minimumInput2_curve.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_minimumInput3.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_minimumInput3_curve.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_minimumOutput1.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_minimumOutput2.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_minimumOutput2_curve.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_minimumOutput3.png
/usr/share/doc/qt/qtgraphicaleffects/images/LevelAdjust_minimumOutput3_curve.png
/usr/share/doc/qt/qtgraphicaleffects/images/LinearGradient.png
/usr/share/doc/qt/qtgraphicaleffects/images/LinearGradient_end1.png
/usr/share/doc/qt/qtgraphicaleffects/images/LinearGradient_end2.png
/usr/share/doc/qt/qtgraphicaleffects/images/LinearGradient_end3.png
/usr/share/doc/qt/qtgraphicaleffects/images/LinearGradient_gradient1.png
/usr/share/doc/qt/qtgraphicaleffects/images/LinearGradient_gradient2.png
/usr/share/doc/qt/qtgraphicaleffects/images/LinearGradient_gradient3.png
/usr/share/doc/qt/qtgraphicaleffects/images/LinearGradient_maskSource1.png
/usr/share/doc/qt/qtgraphicaleffects/images/LinearGradient_maskSource2.png
/usr/share/doc/qt/qtgraphicaleffects/images/LinearGradient_start1.png
/usr/share/doc/qt/qtgraphicaleffects/images/LinearGradient_start2.png
/usr/share/doc/qt/qtgraphicaleffects/images/LinearGradient_start3.png
/usr/share/doc/qt/qtgraphicaleffects/images/MaskedBlur_bug.png
/usr/share/doc/qt/qtgraphicaleffects/images/MaskedBlur_mask.png
/usr/share/doc/qt/qtgraphicaleffects/images/MaskedBlur_radius1.png
/usr/share/doc/qt/qtgraphicaleffects/images/MaskedBlur_radius2.png
/usr/share/doc/qt/qtgraphicaleffects/images/MaskedBlur_radius3.png
/usr/share/doc/qt/qtgraphicaleffects/images/OpacityMask_bug.png
/usr/share/doc/qt/qtgraphicaleffects/images/OpacityMask_mask.png
/usr/share/doc/qt/qtgraphicaleffects/images/Original_bug.png
/usr/share/doc/qt/qtgraphicaleffects/images/Original_butterfly.png
/usr/share/doc/qt/qtgraphicaleffects/images/Original_butterfly_black.png
/usr/share/doc/qt/qtgraphicaleffects/images/RadialBlur_angle1.png
/usr/share/doc/qt/qtgraphicaleffects/images/RadialBlur_angle2.png
/usr/share/doc/qt/qtgraphicaleffects/images/RadialBlur_angle3.png
/usr/share/doc/qt/qtgraphicaleffects/images/RadialBlur_bug.png
/usr/share/doc/qt/qtgraphicaleffects/images/RadialBlur_horizontalOffset1.png
/usr/share/doc/qt/qtgraphicaleffects/images/RadialBlur_horizontalOffset2.png
/usr/share/doc/qt/qtgraphicaleffects/images/RadialBlur_horizontalOffset3.png
/usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient.png
/usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_angle1.png
/usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_angle2.png
/usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_angle3.png
/usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_gradient1.png
/usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_gradient2.png
/usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_gradient3.png
/usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_horizontalOffset1.png
/usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_horizontalOffset2.png
/usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_horizontalOffset3.png
/usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_horizontalRadius1.png
/usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_horizontalRadius2.png
/usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_maskSource1.png
/usr/share/doc/qt/qtgraphicaleffects/images/RadialGradient_maskSource2.png
/usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_applied.png
/usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_color1.png
/usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_color2.png
/usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_color3.png
/usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_cornerRadius1.png
/usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_cornerRadius2.png
/usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_cornerRadius3.png
/usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_glowRadius1.png
/usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_glowRadius2.png
/usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_glowRadius3.png
/usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_spread1.png
/usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_spread2.png
/usr/share/doc/qt/qtgraphicaleffects/images/RectangularGlow_spread3.png
/usr/share/doc/qt/qtgraphicaleffects/images/RecursiveBlur_bug.png
/usr/share/doc/qt/qtgraphicaleffects/images/RecursiveBlur_loops1.png
/usr/share/doc/qt/qtgraphicaleffects/images/RecursiveBlur_loops2.png
/usr/share/doc/qt/qtgraphicaleffects/images/RecursiveBlur_loops3.png
/usr/share/doc/qt/qtgraphicaleffects/images/RecursiveBlur_radius1.png
/usr/share/doc/qt/qtgraphicaleffects/images/RecursiveBlur_radius2.png
/usr/share/doc/qt/qtgraphicaleffects/images/RecursiveBlur_radius3.png
/usr/share/doc/qt/qtgraphicaleffects/images/RecursiveBlur_transparentBorder1.png
/usr/share/doc/qt/qtgraphicaleffects/images/RecursiveBlur_transparentBorder2.png
/usr/share/doc/qt/qtgraphicaleffects/images/ThresholdMask_bug.png
/usr/share/doc/qt/qtgraphicaleffects/images/ThresholdMask_mask.png
/usr/share/doc/qt/qtgraphicaleffects/images/ThresholdMask_spread1.png
/usr/share/doc/qt/qtgraphicaleffects/images/ThresholdMask_spread2.png
/usr/share/doc/qt/qtgraphicaleffects/images/ThresholdMask_spread3.png
/usr/share/doc/qt/qtgraphicaleffects/images/ThresholdMask_threshold1.png
/usr/share/doc/qt/qtgraphicaleffects/images/ThresholdMask_threshold2.png
/usr/share/doc/qt/qtgraphicaleffects/images/ThresholdMask_threshold3.png
/usr/share/doc/qt/qtgraphicaleffects/images/ZoomBlur_bug.png
/usr/share/doc/qt/qtgraphicaleffects/images/ZoomBlur_horizontalOffset1.png
/usr/share/doc/qt/qtgraphicaleffects/images/ZoomBlur_horizontalOffset2.png
/usr/share/doc/qt/qtgraphicaleffects/images/ZoomBlur_horizontalOffset3.png
/usr/share/doc/qt/qtgraphicaleffects/images/ZoomBlur_length1.png
/usr/share/doc/qt/qtgraphicaleffects/images/ZoomBlur_length2.png
/usr/share/doc/qt/qtgraphicaleffects/images/ZoomBlur_length3.png
/usr/share/doc/qt/qtgraphicaleffects/images/arrow_bc.png
/usr/share/doc/qt/qtgraphicaleffects/images/bgrContent.png
/usr/share/doc/qt/qtgraphicaleffects/images/btn_next.png
/usr/share/doc/qt/qtgraphicaleffects/images/btn_prev.png
/usr/share/doc/qt/qtgraphicaleffects/images/bullet_dn.png
/usr/share/doc/qt/qtgraphicaleffects/images/bullet_sq.png
/usr/share/doc/qt/qtgraphicaleffects/images/home.png
/usr/share/doc/qt/qtgraphicaleffects/images/ico_note.png
/usr/share/doc/qt/qtgraphicaleffects/images/ico_note_attention.png
/usr/share/doc/qt/qtgraphicaleffects/images/ico_out.png
/usr/share/doc/qt/qtgraphicaleffects/images/logo.png
/usr/share/doc/qt/qtgraphicaleffects/style/offline-simple.css
/usr/share/doc/qt/qtgraphicaleffects/style/offline.css
/usr/share/doc/qt/qtgui/coordsys.html
/usr/share/doc/qt/qtgui/dnd.html
/usr/share/doc/qt/qtgui/examples-manifest.xml
/usr/share/doc/qt/qtgui/painting-3d.html
/usr/share/doc/qt/qtgui/painting.html
/usr/share/doc/qt/qtgui/paintsystem-devices.html
/usr/share/doc/qt/qtgui/paintsystem-drawing.html
/usr/share/doc/qt/qtgui/paintsystem-images.html
/usr/share/doc/qt/qtgui/paintsystem.html
/usr/share/doc/qt/qtgui/qabstractopenglfunctions-members.html
/usr/share/doc/qt/qtgui/qabstractopenglfunctions.html
/usr/share/doc/qt/qtgui/qabstracttextdocumentlayout-members.html
/usr/share/doc/qt/qtgui/qabstracttextdocumentlayout-paintcontext-members.html
/usr/share/doc/qt/qtgui/qabstracttextdocumentlayout-paintcontext.html
/usr/share/doc/qt/qtgui/qabstracttextdocumentlayout-selection-members.html
/usr/share/doc/qt/qtgui/qabstracttextdocumentlayout-selection.html
/usr/share/doc/qt/qtgui/qabstracttextdocumentlayout.html
/usr/share/doc/qt/qtgui/qaccessible-members.html
/usr/share/doc/qt/qtgui/qaccessible-obsolete.html
/usr/share/doc/qt/qtgui/qaccessible-state-members.html
/usr/share/doc/qt/qtgui/qaccessible-state.html
/usr/share/doc/qt/qtgui/qaccessible.html
/usr/share/doc/qt/qtgui/qaccessibleactioninterface-members.html
/usr/share/doc/qt/qtgui/qaccessibleactioninterface.html
/usr/share/doc/qt/qtgui/qaccessibleeditabletextinterface-members.html
/usr/share/doc/qt/qtgui/qaccessibleeditabletextinterface.html
/usr/share/doc/qt/qtgui/qaccessibleevent-members.html
/usr/share/doc/qt/qtgui/qaccessibleevent.html
/usr/share/doc/qt/qtgui/qaccessibleinterface-members.html
/usr/share/doc/qt/qtgui/qaccessibleinterface.html
/usr/share/doc/qt/qtgui/qaccessibleobject-members.html
/usr/share/doc/qt/qtgui/qaccessibleobject.html
/usr/share/doc/qt/qtgui/qaccessibleplugin-members.html
/usr/share/doc/qt/qtgui/qaccessibleplugin.html
/usr/share/doc/qt/qtgui/qaccessiblestatechangeevent-members.html
/usr/share/doc/qt/qtgui/qaccessiblestatechangeevent.html
/usr/share/doc/qt/qtgui/qaccessibletablecellinterface-members.html
/usr/share/doc/qt/qtgui/qaccessibletablecellinterface.html
/usr/share/doc/qt/qtgui/qaccessibletableinterface-members.html
/usr/share/doc/qt/qtgui/qaccessibletableinterface.html
/usr/share/doc/qt/qtgui/qaccessibletablemodelchangeevent-members.html
/usr/share/doc/qt/qtgui/qaccessibletablemodelchangeevent.html
/usr/share/doc/qt/qtgui/qaccessibletextcursorevent-members.html
/usr/share/doc/qt/qtgui/qaccessibletextcursorevent.html
/usr/share/doc/qt/qtgui/qaccessibletextinsertevent-members.html
/usr/share/doc/qt/qtgui/qaccessibletextinsertevent.html
/usr/share/doc/qt/qtgui/qaccessibletextinterface-members.html
/usr/share/doc/qt/qtgui/qaccessibletextinterface.html
/usr/share/doc/qt/qtgui/qaccessibletextremoveevent-members.html
/usr/share/doc/qt/qtgui/qaccessibletextremoveevent.html
/usr/share/doc/qt/qtgui/qaccessibletextselectionevent-members.html
/usr/share/doc/qt/qtgui/qaccessibletextselectionevent.html
/usr/share/doc/qt/qtgui/qaccessibletextupdateevent-members.html
/usr/share/doc/qt/qtgui/qaccessibletextupdateevent.html
/usr/share/doc/qt/qtgui/qaccessiblevaluechangeevent-members.html
/usr/share/doc/qt/qtgui/qaccessiblevaluechangeevent.html
/usr/share/doc/qt/qtgui/qaccessiblevalueinterface-members.html
/usr/share/doc/qt/qtgui/qaccessiblevalueinterface.html
/usr/share/doc/qt/qtgui/qactionevent-members.html
/usr/share/doc/qt/qtgui/qactionevent.html
/usr/share/doc/qt/qtgui/qbackingstore-members.html
/usr/share/doc/qt/qtgui/qbackingstore.html
/usr/share/doc/qt/qtgui/qbitmap-members.html
/usr/share/doc/qt/qtgui/qbitmap-obsolete.html
/usr/share/doc/qt/qtgui/qbitmap.html
/usr/share/doc/qt/qtgui/qbrush-members.html
/usr/share/doc/qt/qtgui/qbrush.html
/usr/share/doc/qt/qtgui/qclipboard-members.html
/usr/share/doc/qt/qtgui/qclipboard.html
/usr/share/doc/qt/qtgui/qcloseevent-members.html
/usr/share/doc/qt/qtgui/qcloseevent.html
/usr/share/doc/qt/qtgui/qcolor-members.html
/usr/share/doc/qt/qtgui/qcolor-obsolete.html
/usr/share/doc/qt/qtgui/qcolor.html
/usr/share/doc/qt/qtgui/qconicalgradient-members.html
/usr/share/doc/qt/qtgui/qconicalgradient.html
/usr/share/doc/qt/qtgui/qcontextmenuevent-members.html
/usr/share/doc/qt/qtgui/qcontextmenuevent.html
/usr/share/doc/qt/qtgui/qcursor-members.html
/usr/share/doc/qt/qtgui/qcursor.html
/usr/share/doc/qt/qtgui/qdesktopservices-members.html
/usr/share/doc/qt/qtgui/qdesktopservices-obsolete.html
/usr/share/doc/qt/qtgui/qdesktopservices.html
/usr/share/doc/qt/qtgui/qdoublevalidator-members.html
/usr/share/doc/qt/qtgui/qdoublevalidator.html
/usr/share/doc/qt/qtgui/qdrag-members.html
/usr/share/doc/qt/qtgui/qdrag-obsolete.html
/usr/share/doc/qt/qtgui/qdrag.html
/usr/share/doc/qt/qtgui/qdragenterevent-members.html
/usr/share/doc/qt/qtgui/qdragenterevent.html
/usr/share/doc/qt/qtgui/qdragleaveevent-members.html
/usr/share/doc/qt/qtgui/qdragleaveevent.html
/usr/share/doc/qt/qtgui/qdragmoveevent-members.html
/usr/share/doc/qt/qtgui/qdragmoveevent.html
/usr/share/doc/qt/qtgui/qdropevent-members.html
/usr/share/doc/qt/qtgui/qdropevent.html
/usr/share/doc/qt/qtgui/qenterevent-members.html
/usr/share/doc/qt/qtgui/qenterevent.html
/usr/share/doc/qt/qtgui/qexposeevent-members.html
/usr/share/doc/qt/qtgui/qexposeevent.html
/usr/share/doc/qt/qtgui/qfileopenevent-members.html
/usr/share/doc/qt/qtgui/qfileopenevent.html
/usr/share/doc/qt/qtgui/qfocusevent-members.html
/usr/share/doc/qt/qtgui/qfocusevent.html
/usr/share/doc/qt/qtgui/qfont-members.html
/usr/share/doc/qt/qtgui/qfont-obsolete.html
/usr/share/doc/qt/qtgui/qfont.html
/usr/share/doc/qt/qtgui/qfontdatabase-members.html
/usr/share/doc/qt/qtgui/qfontdatabase-obsolete.html
/usr/share/doc/qt/qtgui/qfontdatabase.html
/usr/share/doc/qt/qtgui/qfontinfo-members.html
/usr/share/doc/qt/qtgui/qfontinfo-obsolete.html
/usr/share/doc/qt/qtgui/qfontinfo.html
/usr/share/doc/qt/qtgui/qfontmetrics-members.html
/usr/share/doc/qt/qtgui/qfontmetrics-obsolete.html
/usr/share/doc/qt/qtgui/qfontmetrics.html
/usr/share/doc/qt/qtgui/qfontmetricsf-members.html
/usr/share/doc/qt/qtgui/qfontmetricsf-obsolete.html
/usr/share/doc/qt/qtgui/qfontmetricsf.html
/usr/share/doc/qt/qtgui/qgenericmatrix-members.html
/usr/share/doc/qt/qtgui/qgenericmatrix.html
/usr/share/doc/qt/qtgui/qgenericplugin-members.html
/usr/share/doc/qt/qtgui/qgenericplugin.html
/usr/share/doc/qt/qtgui/qgenericpluginfactory-members.html
/usr/share/doc/qt/qtgui/qgenericpluginfactory.html
/usr/share/doc/qt/qtgui/qglyphrun-members.html
/usr/share/doc/qt/qtgui/qglyphrun.html
/usr/share/doc/qt/qtgui/qgradient-members.html
/usr/share/doc/qt/qtgui/qgradient.html
/usr/share/doc/qt/qtgui/qguiapplication-members.html
/usr/share/doc/qt/qtgui/qguiapplication.html
/usr/share/doc/qt/qtgui/qhelpevent-members.html
/usr/share/doc/qt/qtgui/qhelpevent.html
/usr/share/doc/qt/qtgui/qhideevent-members.html
/usr/share/doc/qt/qtgui/qhideevent.html
/usr/share/doc/qt/qtgui/qhoverevent-members.html
/usr/share/doc/qt/qtgui/qhoverevent.html
/usr/share/doc/qt/qtgui/qicon-members.html
/usr/share/doc/qt/qtgui/qicon-obsolete.html
/usr/share/doc/qt/qtgui/qicon.html
/usr/share/doc/qt/qtgui/qicondragevent-members.html
/usr/share/doc/qt/qtgui/qicondragevent.html
/usr/share/doc/qt/qtgui/qiconengine-availablesizesargument-members.html
/usr/share/doc/qt/qtgui/qiconengine-availablesizesargument.html
/usr/share/doc/qt/qtgui/qiconengine-members.html
/usr/share/doc/qt/qtgui/qiconengine-scaledpixmapargument-members.html
/usr/share/doc/qt/qtgui/qiconengine-scaledpixmapargument.html
/usr/share/doc/qt/qtgui/qiconengine.html
/usr/share/doc/qt/qtgui/qiconengineplugin-members.html
/usr/share/doc/qt/qtgui/qiconengineplugin.html
/usr/share/doc/qt/qtgui/qimage-members.html
/usr/share/doc/qt/qtgui/qimage-obsolete.html
/usr/share/doc/qt/qtgui/qimage.html
/usr/share/doc/qt/qtgui/qimageiohandler-members.html
/usr/share/doc/qt/qtgui/qimageiohandler-obsolete.html
/usr/share/doc/qt/qtgui/qimageiohandler.html
/usr/share/doc/qt/qtgui/qimageioplugin-members.html
/usr/share/doc/qt/qtgui/qimageioplugin.html
/usr/share/doc/qt/qtgui/qimagereader-members.html
/usr/share/doc/qt/qtgui/qimagereader.html
/usr/share/doc/qt/qtgui/qimagewriter-members.html
/usr/share/doc/qt/qtgui/qimagewriter-obsolete.html
/usr/share/doc/qt/qtgui/qimagewriter.html
/usr/share/doc/qt/qtgui/qinputevent-members.html
/usr/share/doc/qt/qtgui/qinputevent.html
/usr/share/doc/qt/qtgui/qinputmethod-members.html
/usr/share/doc/qt/qtgui/qinputmethod.html
/usr/share/doc/qt/qtgui/qinputmethodevent-attribute-members.html
/usr/share/doc/qt/qtgui/qinputmethodevent-attribute.html
/usr/share/doc/qt/qtgui/qinputmethodevent-members.html
/usr/share/doc/qt/qtgui/qinputmethodevent.html
/usr/share/doc/qt/qtgui/qinputmethodqueryevent-members.html
/usr/share/doc/qt/qtgui/qinputmethodqueryevent.html
/usr/share/doc/qt/qtgui/qintvalidator-members.html
/usr/share/doc/qt/qtgui/qintvalidator.html
/usr/share/doc/qt/qtgui/qkeyevent-members.html
/usr/share/doc/qt/qtgui/qkeyevent.html
/usr/share/doc/qt/qtgui/qkeysequence-members.html
/usr/share/doc/qt/qtgui/qkeysequence-obsolete.html
/usr/share/doc/qt/qtgui/qkeysequence.html
/usr/share/doc/qt/qtgui/qlineargradient-members.html
/usr/share/doc/qt/qtgui/qlineargradient.html
/usr/share/doc/qt/qtgui/qmatrix-members.html
/usr/share/doc/qt/qtgui/qmatrix.html
/usr/share/doc/qt/qtgui/qmatrix4x4-members.html
/usr/share/doc/qt/qtgui/qmatrix4x4-obsolete.html
/usr/share/doc/qt/qtgui/qmatrix4x4.html
/usr/share/doc/qt/qtgui/qmouseevent-members.html
/usr/share/doc/qt/qtgui/qmouseevent-obsolete.html
/usr/share/doc/qt/qtgui/qmouseevent.html
/usr/share/doc/qt/qtgui/qmoveevent-members.html
/usr/share/doc/qt/qtgui/qmoveevent.html
/usr/share/doc/qt/qtgui/qmovie-members.html
/usr/share/doc/qt/qtgui/qmovie.html
/usr/share/doc/qt/qtgui/qnativegestureevent-members.html
/usr/share/doc/qt/qtgui/qnativegestureevent-obsolete.html
/usr/share/doc/qt/qtgui/qnativegestureevent.html
/usr/share/doc/qt/qtgui/qoffscreensurface-members.html
/usr/share/doc/qt/qtgui/qoffscreensurface.html
/usr/share/doc/qt/qtgui/qopenglbuffer-members.html
/usr/share/doc/qt/qtgui/qopenglbuffer.html
/usr/share/doc/qt/qtgui/qopenglcontext-members.html
/usr/share/doc/qt/qtgui/qopenglcontext.html
/usr/share/doc/qt/qtgui/qopenglcontextgroup-members.html
/usr/share/doc/qt/qtgui/qopenglcontextgroup.html
/usr/share/doc/qt/qtgui/qopengldebuglogger-members.html
/usr/share/doc/qt/qtgui/qopengldebuglogger.html
/usr/share/doc/qt/qtgui/qopengldebugmessage-members.html
/usr/share/doc/qt/qtgui/qopengldebugmessage.html
/usr/share/doc/qt/qtgui/qopenglextrafunctions-members.html
/usr/share/doc/qt/qtgui/qopenglextrafunctions.html
/usr/share/doc/qt/qtgui/qopenglframebufferobject-members.html
/usr/share/doc/qt/qtgui/qopenglframebufferobject.html
/usr/share/doc/qt/qtgui/qopenglframebufferobjectformat-members.html
/usr/share/doc/qt/qtgui/qopenglframebufferobjectformat.html
/usr/share/doc/qt/qtgui/qopenglfunctions-1-0.html
/usr/share/doc/qt/qtgui/qopenglfunctions-1-1.html
/usr/share/doc/qt/qtgui/qopenglfunctions-1-2.html
/usr/share/doc/qt/qtgui/qopenglfunctions-1-3.html
/usr/share/doc/qt/qtgui/qopenglfunctions-1-4.html
/usr/share/doc/qt/qtgui/qopenglfunctions-1-5.html
/usr/share/doc/qt/qtgui/qopenglfunctions-2-0.html
/usr/share/doc/qt/qtgui/qopenglfunctions-2-1.html
/usr/share/doc/qt/qtgui/qopenglfunctions-3-0.html
/usr/share/doc/qt/qtgui/qopenglfunctions-3-1.html
/usr/share/doc/qt/qtgui/qopenglfunctions-3-2-compatibility.html
/usr/share/doc/qt/qtgui/qopenglfunctions-3-2-core.html
/usr/share/doc/qt/qtgui/qopenglfunctions-3-3-compatibility.html
/usr/share/doc/qt/qtgui/qopenglfunctions-3-3-core.html
/usr/share/doc/qt/qtgui/qopenglfunctions-4-0-compatibility.html
/usr/share/doc/qt/qtgui/qopenglfunctions-4-0-core.html
/usr/share/doc/qt/qtgui/qopenglfunctions-4-1-compatibility.html
/usr/share/doc/qt/qtgui/qopenglfunctions-4-1-core.html
/usr/share/doc/qt/qtgui/qopenglfunctions-4-2-compatibility.html
/usr/share/doc/qt/qtgui/qopenglfunctions-4-2-core.html
/usr/share/doc/qt/qtgui/qopenglfunctions-4-3-compatibility.html
/usr/share/doc/qt/qtgui/qopenglfunctions-4-3-core.html
/usr/share/doc/qt/qtgui/qopenglfunctions-4-4-compatibility.html
/usr/share/doc/qt/qtgui/qopenglfunctions-4-4-core.html
/usr/share/doc/qt/qtgui/qopenglfunctions-4-5-compatibility.html
/usr/share/doc/qt/qtgui/qopenglfunctions-4-5-core.html
/usr/share/doc/qt/qtgui/qopenglfunctions-es2.html
/usr/share/doc/qt/qtgui/qopenglfunctions-members.html
/usr/share/doc/qt/qtgui/qopenglfunctions-obsolete.html
/usr/share/doc/qt/qtgui/qopenglfunctions.html
/usr/share/doc/qt/qtgui/qopenglpaintdevice-members.html
/usr/share/doc/qt/qtgui/qopenglpaintdevice.html
/usr/share/doc/qt/qtgui/qopenglpixeltransferoptions-members.html
/usr/share/doc/qt/qtgui/qopenglpixeltransferoptions.html
/usr/share/doc/qt/qtgui/qopenglshader-members.html
/usr/share/doc/qt/qtgui/qopenglshader.html
/usr/share/doc/qt/qtgui/qopenglshaderprogram-members.html
/usr/share/doc/qt/qtgui/qopenglshaderprogram.html
/usr/share/doc/qt/qtgui/qopengltexture-members.html
/usr/share/doc/qt/qtgui/qopengltexture-obsolete.html
/usr/share/doc/qt/qtgui/qopengltexture.html
/usr/share/doc/qt/qtgui/qopengltextureblitter-members.html
/usr/share/doc/qt/qtgui/qopengltextureblitter.html
/usr/share/doc/qt/qtgui/qopengltimemonitor-members.html
/usr/share/doc/qt/qtgui/qopengltimemonitor.html
/usr/share/doc/qt/qtgui/qopengltimerquery-members.html
/usr/share/doc/qt/qtgui/qopengltimerquery.html
/usr/share/doc/qt/qtgui/qopenglversionprofile-members.html
/usr/share/doc/qt/qtgui/qopenglversionprofile.html
/usr/share/doc/qt/qtgui/qopenglvertexarrayobject-binder-members.html
/usr/share/doc/qt/qtgui/qopenglvertexarrayobject-binder.html
/usr/share/doc/qt/qtgui/qopenglvertexarrayobject-members.html
/usr/share/doc/qt/qtgui/qopenglvertexarrayobject.html
/usr/share/doc/qt/qtgui/qopenglwindow-members.html
/usr/share/doc/qt/qtgui/qopenglwindow.html
/usr/share/doc/qt/qtgui/qpagedpaintdevice-members.html
/usr/share/doc/qt/qtgui/qpagedpaintdevice-obsolete.html
/usr/share/doc/qt/qtgui/qpagedpaintdevice.html
/usr/share/doc/qt/qtgui/qpagelayout-members.html
/usr/share/doc/qt/qtgui/qpagelayout.html
/usr/share/doc/qt/qtgui/qpagesize-members.html
/usr/share/doc/qt/qtgui/qpagesize.html
/usr/share/doc/qt/qtgui/qpaintdevice-members.html
/usr/share/doc/qt/qtgui/qpaintdevice.html
/usr/share/doc/qt/qtgui/qpaintdevicewindow-members.html
/usr/share/doc/qt/qtgui/qpaintdevicewindow.html
/usr/share/doc/qt/qtgui/qpaintengine-members.html
/usr/share/doc/qt/qtgui/qpaintengine.html
/usr/share/doc/qt/qtgui/qpaintenginestate-members.html
/usr/share/doc/qt/qtgui/qpaintenginestate-obsolete.html
/usr/share/doc/qt/qtgui/qpaintenginestate.html
/usr/share/doc/qt/qtgui/qpainter-members.html
/usr/share/doc/qt/qtgui/qpainter-obsolete.html
/usr/share/doc/qt/qtgui/qpainter-pixmapfragment-members.html
/usr/share/doc/qt/qtgui/qpainter-pixmapfragment.html
/usr/share/doc/qt/qtgui/qpainter.html
/usr/share/doc/qt/qtgui/qpainterpath-element-members.html
/usr/share/doc/qt/qtgui/qpainterpath-element.html
/usr/share/doc/qt/qtgui/qpainterpath-members.html
/usr/share/doc/qt/qtgui/qpainterpath-obsolete.html
/usr/share/doc/qt/qtgui/qpainterpath.html
/usr/share/doc/qt/qtgui/qpainterpathstroker-members.html
/usr/share/doc/qt/qtgui/qpainterpathstroker.html
/usr/share/doc/qt/qtgui/qpaintevent-members.html
/usr/share/doc/qt/qtgui/qpaintevent.html
/usr/share/doc/qt/qtgui/qpalette-members.html
/usr/share/doc/qt/qtgui/qpalette-obsolete.html
/usr/share/doc/qt/qtgui/qpalette.html
/usr/share/doc/qt/qtgui/qpdfwriter-members.html
/usr/share/doc/qt/qtgui/qpdfwriter.html
/usr/share/doc/qt/qtgui/qpen-members.html
/usr/share/doc/qt/qtgui/qpen.html
/usr/share/doc/qt/qtgui/qpicture-members.html
/usr/share/doc/qt/qtgui/qpicture.html
/usr/share/doc/qt/qtgui/qpictureformatplugin-members.html
/usr/share/doc/qt/qtgui/qpictureformatplugin.html
/usr/share/doc/qt/qtgui/qpictureio-members.html
/usr/share/doc/qt/qtgui/qpictureio.html
/usr/share/doc/qt/qtgui/qpixelformat-members.html
/usr/share/doc/qt/qtgui/qpixelformat.html
/usr/share/doc/qt/qtgui/qpixmap-members.html
/usr/share/doc/qt/qtgui/qpixmap-obsolete.html
/usr/share/doc/qt/qtgui/qpixmap.html
/usr/share/doc/qt/qtgui/qpixmapcache-key-members.html
/usr/share/doc/qt/qtgui/qpixmapcache-key.html
/usr/share/doc/qt/qtgui/qpixmapcache-members.html
/usr/share/doc/qt/qtgui/qpixmapcache-obsolete.html
/usr/share/doc/qt/qtgui/qpixmapcache.html
/usr/share/doc/qt/qtgui/qplatformsurfaceevent-members.html
/usr/share/doc/qt/qtgui/qplatformsurfaceevent.html
/usr/share/doc/qt/qtgui/qpointingdeviceuniqueid-members.html
/usr/share/doc/qt/qtgui/qpointingdeviceuniqueid.html
/usr/share/doc/qt/qtgui/qpolygon-members.html
/usr/share/doc/qt/qtgui/qpolygon.html
/usr/share/doc/qt/qtgui/qpolygonf-members.html
/usr/share/doc/qt/qtgui/qpolygonf.html
/usr/share/doc/qt/qtgui/qquaternion-members.html
/usr/share/doc/qt/qtgui/qquaternion-obsolete.html
/usr/share/doc/qt/qtgui/qquaternion.html
/usr/share/doc/qt/qtgui/qradialgradient-members.html
/usr/share/doc/qt/qtgui/qradialgradient.html
/usr/share/doc/qt/qtgui/qrasterpaintengine-members.html
/usr/share/doc/qt/qtgui/qrasterpaintengine.html
/usr/share/doc/qt/qtgui/qrasterwindow-members.html
/usr/share/doc/qt/qtgui/qrasterwindow.html
/usr/share/doc/qt/qtgui/qrawfont-members.html
/usr/share/doc/qt/qtgui/qrawfont.html
/usr/share/doc/qt/qtgui/qregexpvalidator-members.html
/usr/share/doc/qt/qtgui/qregexpvalidator.html
/usr/share/doc/qt/qtgui/qregion-members.html
/usr/share/doc/qt/qtgui/qregion-obsolete.html
/usr/share/doc/qt/qtgui/qregion.html
/usr/share/doc/qt/qtgui/qregularexpressionvalidator-members.html
/usr/share/doc/qt/qtgui/qregularexpressionvalidator.html
/usr/share/doc/qt/qtgui/qresizeevent-members.html
/usr/share/doc/qt/qtgui/qresizeevent.html
/usr/share/doc/qt/qtgui/qrgba64-members.html
/usr/share/doc/qt/qtgui/qrgba64.html
/usr/share/doc/qt/qtgui/qscreen-members.html
/usr/share/doc/qt/qtgui/qscreen.html
/usr/share/doc/qt/qtgui/qscrollevent-members.html
/usr/share/doc/qt/qtgui/qscrollevent.html
/usr/share/doc/qt/qtgui/qscrollprepareevent-members.html
/usr/share/doc/qt/qtgui/qscrollprepareevent.html
/usr/share/doc/qt/qtgui/qsessionmanager-members.html
/usr/share/doc/qt/qtgui/qsessionmanager.html
/usr/share/doc/qt/qtgui/qshortcutevent-members.html
/usr/share/doc/qt/qtgui/qshortcutevent.html
/usr/share/doc/qt/qtgui/qshowevent-members.html
/usr/share/doc/qt/qtgui/qshowevent.html
/usr/share/doc/qt/qtgui/qstandarditem-members.html
/usr/share/doc/qt/qtgui/qstandarditem-obsolete.html
/usr/share/doc/qt/qtgui/qstandarditem.html
/usr/share/doc/qt/qtgui/qstandarditemmodel-members.html
/usr/share/doc/qt/qtgui/qstandarditemmodel.html
/usr/share/doc/qt/qtgui/qstatictext-members.html
/usr/share/doc/qt/qtgui/qstatictext.html
/usr/share/doc/qt/qtgui/qstatustipevent-members.html
/usr/share/doc/qt/qtgui/qstatustipevent.html
/usr/share/doc/qt/qtgui/qstylehints-members.html
/usr/share/doc/qt/qtgui/qstylehints.html
/usr/share/doc/qt/qtgui/qsupportedwritingsystems-members.html
/usr/share/doc/qt/qtgui/qsupportedwritingsystems.html
/usr/share/doc/qt/qtgui/qsurface-members.html
/usr/share/doc/qt/qtgui/qsurface.html
/usr/share/doc/qt/qtgui/qsurfaceformat-members.html
/usr/share/doc/qt/qtgui/qsurfaceformat-obsolete.html
/usr/share/doc/qt/qtgui/qsurfaceformat.html
/usr/share/doc/qt/qtgui/qsyntaxhighlighter-members.html
/usr/share/doc/qt/qtgui/qsyntaxhighlighter.html
/usr/share/doc/qt/qtgui/qt-sub-qtgui.html
/usr/share/doc/qt/qtgui/qtabletevent-members.html
/usr/share/doc/qt/qtgui/qtabletevent-obsolete.html
/usr/share/doc/qt/qtgui/qtabletevent.html
/usr/share/doc/qt/qtgui/qtextblock-iterator-members.html
/usr/share/doc/qt/qtgui/qtextblock-iterator.html
/usr/share/doc/qt/qtgui/qtextblock-members.html
/usr/share/doc/qt/qtgui/qtextblock.html
/usr/share/doc/qt/qtgui/qtextblockformat-members.html
/usr/share/doc/qt/qtgui/qtextblockformat.html
/usr/share/doc/qt/qtgui/qtextblockgroup-members.html
/usr/share/doc/qt/qtgui/qtextblockgroup.html
/usr/share/doc/qt/qtgui/qtextblockuserdata-members.html
/usr/share/doc/qt/qtgui/qtextblockuserdata.html
/usr/share/doc/qt/qtgui/qtextcharformat-members.html
/usr/share/doc/qt/qtgui/qtextcharformat-obsolete.html
/usr/share/doc/qt/qtgui/qtextcharformat.html
/usr/share/doc/qt/qtgui/qtextcursor-members.html
/usr/share/doc/qt/qtgui/qtextcursor.html
/usr/share/doc/qt/qtgui/qtextdocument-members.html
/usr/share/doc/qt/qtgui/qtextdocument.html
/usr/share/doc/qt/qtgui/qtextdocumentfragment-members.html
/usr/share/doc/qt/qtgui/qtextdocumentfragment.html
/usr/share/doc/qt/qtgui/qtextdocumentwriter-members.html
/usr/share/doc/qt/qtgui/qtextdocumentwriter.html
/usr/share/doc/qt/qtgui/qtextformat-members.html
/usr/share/doc/qt/qtgui/qtextformat.html
/usr/share/doc/qt/qtgui/qtextfragment-members.html
/usr/share/doc/qt/qtgui/qtextfragment.html
/usr/share/doc/qt/qtgui/qtextframe-iterator-members.html
/usr/share/doc/qt/qtgui/qtextframe-iterator.html
/usr/share/doc/qt/qtgui/qtextframe-members.html
/usr/share/doc/qt/qtgui/qtextframe.html
/usr/share/doc/qt/qtgui/qtextframeformat-members.html
/usr/share/doc/qt/qtgui/qtextframeformat.html
/usr/share/doc/qt/qtgui/qtextimageformat-members.html
/usr/share/doc/qt/qtgui/qtextimageformat.html
/usr/share/doc/qt/qtgui/qtextinlineobject-members.html
/usr/share/doc/qt/qtgui/qtextinlineobject.html
/usr/share/doc/qt/qtgui/qtextitem-members.html
/usr/share/doc/qt/qtgui/qtextitem.html
/usr/share/doc/qt/qtgui/qtextlayout-formatrange-members.html
/usr/share/doc/qt/qtgui/qtextlayout-formatrange.html
/usr/share/doc/qt/qtgui/qtextlayout-members.html
/usr/share/doc/qt/qtgui/qtextlayout-obsolete.html
/usr/share/doc/qt/qtgui/qtextlayout.html
/usr/share/doc/qt/qtgui/qtextlength-members.html
/usr/share/doc/qt/qtgui/qtextlength.html
/usr/share/doc/qt/qtgui/qtextline-members.html
/usr/share/doc/qt/qtgui/qtextline.html
/usr/share/doc/qt/qtgui/qtextlist-members.html
/usr/share/doc/qt/qtgui/qtextlist-obsolete.html
/usr/share/doc/qt/qtgui/qtextlist.html
/usr/share/doc/qt/qtgui/qtextlistformat-members.html
/usr/share/doc/qt/qtgui/qtextlistformat.html
/usr/share/doc/qt/qtgui/qtextobject-members.html
/usr/share/doc/qt/qtgui/qtextobject.html
/usr/share/doc/qt/qtgui/qtextobjectinterface-members.html
/usr/share/doc/qt/qtgui/qtextobjectinterface.html
/usr/share/doc/qt/qtgui/qtextoption-members.html
/usr/share/doc/qt/qtgui/qtextoption-obsolete.html
/usr/share/doc/qt/qtgui/qtextoption-tab-members.html
/usr/share/doc/qt/qtgui/qtextoption-tab.html
/usr/share/doc/qt/qtgui/qtextoption.html
/usr/share/doc/qt/qtgui/qtexttable-members.html
/usr/share/doc/qt/qtgui/qtexttable.html
/usr/share/doc/qt/qtgui/qtexttablecell-members.html
/usr/share/doc/qt/qtgui/qtexttablecell.html
/usr/share/doc/qt/qtgui/qtexttablecellformat-members.html
/usr/share/doc/qt/qtgui/qtexttablecellformat.html
/usr/share/doc/qt/qtgui/qtexttableformat-members.html
/usr/share/doc/qt/qtgui/qtexttableformat.html
/usr/share/doc/qt/qtgui/qtgui-analogclock-example.html
/usr/share/doc/qt/qtgui/qtgui-attribution-android-native-style.html
/usr/share/doc/qt/qtgui/qtgui-attribution-angle-arrayboundsclamper.html
/usr/share/doc/qt/qtgui/qtgui-attribution-angle-murmurhash.html
/usr/share/doc/qt/qtgui/qtgui-attribution-angle-systeminfo.html
/usr/share/doc/qt/qtgui/qtgui-attribution-angle-trace-event.html
/usr/share/doc/qt/qtgui/qtgui-attribution-angle.html
/usr/share/doc/qt/qtgui/qtgui-attribution-cocoa-platform-plugin.html
/usr/share/doc/qt/qtgui/qtgui-attribution-dejayvu.html
/usr/share/doc/qt/qtgui/qtgui-attribution-freetype-bdf.html
/usr/share/doc/qt/qtgui/qtgui-attribution-freetype-pcf.html
/usr/share/doc/qt/qtgui/qtgui-attribution-freetype-zlib.html
/usr/share/doc/qt/qtgui/qtgui-attribution-freetype.html
/usr/share/doc/qt/qtgui/qtgui-attribution-grayraster.html
/usr/share/doc/qt/qtgui/qtgui-attribution-harfbuzz-ng.html
/usr/share/doc/qt/qtgui/qtgui-attribution-harfbuzz.html
/usr/share/doc/qt/qtgui/qtgui-attribution-iaccessible2.html
/usr/share/doc/qt/qtgui/qtgui-attribution-icc-srgb-color-profile.html
/usr/share/doc/qt/qtgui/qtgui-attribution-libjpeg.html
/usr/share/doc/qt/qtgui/qtgui-attribution-libpng.html
/usr/share/doc/qt/qtgui/qtgui-attribution-opengl-es2-headers.html
/usr/share/doc/qt/qtgui/qtgui-attribution-opengl-headers.html
/usr/share/doc/qt/qtgui/qtgui-attribution-pixman.html
/usr/share/doc/qt/qtgui/qtgui-attribution-smooth-scaling-algorithm.html
/usr/share/doc/qt/qtgui/qtgui-attribution-vera-font.html
/usr/share/doc/qt/qtgui/qtgui-attribution-vulkan-xml-spec.html
/usr/share/doc/qt/qtgui/qtgui-attribution-webgradients.html
/usr/share/doc/qt/qtgui/qtgui-attribution-wintab.html
/usr/share/doc/qt/qtgui/qtgui-attribution-xcb.html
/usr/share/doc/qt/qtgui/qtgui-hellovulkancubes-example.html
/usr/share/doc/qt/qtgui/qtgui-hellovulkantexture-example.html
/usr/share/doc/qt/qtgui/qtgui-hellovulkantriangle-example.html
/usr/share/doc/qt/qtgui/qtgui-hellovulkanwidget-example.html
/usr/share/doc/qt/qtgui/qtgui-hellovulkanwindow-example.html
/usr/share/doc/qt/qtgui/qtgui-index.html
/usr/share/doc/qt/qtgui/qtgui-module.html
/usr/share/doc/qt/qtgui/qtgui-openglwindow-example.html
/usr/share/doc/qt/qtgui/qtgui-rasterwindow-example.html
/usr/share/doc/qt/qtgui/qtgui.index
/usr/share/doc/qt/qtgui/qtgui.qhp
/usr/share/doc/qt/qtgui/qtgui.qhp.sha1
/usr/share/doc/qt/qtgui/qtgui.tags
/usr/share/doc/qt/qtgui/qtouchdevice-members.html
/usr/share/doc/qt/qtgui/qtouchdevice.html
/usr/share/doc/qt/qtgui/qtouchevent-members.html
/usr/share/doc/qt/qtgui/qtouchevent-obsolete.html
/usr/share/doc/qt/qtgui/qtouchevent-touchpoint-members.html
/usr/share/doc/qt/qtgui/qtouchevent-touchpoint-obsolete.html
/usr/share/doc/qt/qtgui/qtouchevent-touchpoint.html
/usr/share/doc/qt/qtgui/qtouchevent.html
/usr/share/doc/qt/qtgui/qtransform-members.html
/usr/share/doc/qt/qtgui/qtransform-obsolete.html
/usr/share/doc/qt/qtgui/qtransform.html
/usr/share/doc/qt/qtgui/qvalidator-members.html
/usr/share/doc/qt/qtgui/qvalidator.html
/usr/share/doc/qt/qtgui/qvector2d-members.html
/usr/share/doc/qt/qtgui/qvector2d.html
/usr/share/doc/qt/qtgui/qvector3d-members.html
/usr/share/doc/qt/qtgui/qvector3d.html
/usr/share/doc/qt/qtgui/qvector4d-members.html
/usr/share/doc/qt/qtgui/qvector4d.html
/usr/share/doc/qt/qtgui/qvulkandevicefunctions.html
/usr/share/doc/qt/qtgui/qvulkanextension-members.html
/usr/share/doc/qt/qtgui/qvulkanextension.html
/usr/share/doc/qt/qtgui/qvulkanfunctions.html
/usr/share/doc/qt/qtgui/qvulkaninfovector-members.html
/usr/share/doc/qt/qtgui/qvulkaninfovector.html
/usr/share/doc/qt/qtgui/qvulkaninstance-members.html
/usr/share/doc/qt/qtgui/qvulkaninstance.html
/usr/share/doc/qt/qtgui/qvulkanlayer-members.html
/usr/share/doc/qt/qtgui/qvulkanlayer.html
/usr/share/doc/qt/qtgui/qvulkanwindow-members.html
/usr/share/doc/qt/qtgui/qvulkanwindow.html
/usr/share/doc/qt/qtgui/qvulkanwindowrenderer-members.html
/usr/share/doc/qt/qtgui/qvulkanwindowrenderer.html
/usr/share/doc/qt/qtgui/qwhatsthisclickedevent-members.html
/usr/share/doc/qt/qtgui/qwhatsthisclickedevent.html
/usr/share/doc/qt/qtgui/qwheelevent-members.html
/usr/share/doc/qt/qtgui/qwheelevent-obsolete.html
/usr/share/doc/qt/qtgui/qwheelevent.html
/usr/share/doc/qt/qtgui/qwindow-members.html
/usr/share/doc/qt/qtgui/qwindow.html
/usr/share/doc/qt/qtgui/qwindowstatechangeevent-members.html
/usr/share/doc/qt/qtgui/qwindowstatechangeevent.html
/usr/share/doc/qt/qtgui/richtext-advanced-processing.html
/usr/share/doc/qt/qtgui/richtext-common-tasks.html
/usr/share/doc/qt/qtgui/richtext-cursor.html
/usr/share/doc/qt/qtgui/richtext-html-subset.html
/usr/share/doc/qt/qtgui/richtext-layouts.html
/usr/share/doc/qt/qtgui/richtext-processing.html
/usr/share/doc/qt/qtgui/richtext-structure.html
/usr/share/doc/qt/qtgui/richtext.html
/usr/share/doc/qt/qtgui/images/alphafill.png
/usr/share/doc/qt/qtgui/images/analogclock-window-example.png
/usr/share/doc/qt/qtgui/images/analogclockwindow-viewport.png
/usr/share/doc/qt/qtgui/images/arrow_bc.png
/usr/share/doc/qt/qtgui/images/bearings.png
/usr/share/doc/qt/qtgui/images/bgrContent.png
/usr/share/doc/qt/qtgui/images/brush-outline.png
/usr/share/doc/qt/qtgui/images/brush-styles.png
/usr/share/doc/qt/qtgui/images/btn_next.png
/usr/share/doc/qt/qtgui/images/btn_prev.png
/usr/share/doc/qt/qtgui/images/bullet_dn.png
/usr/share/doc/qt/qtgui/images/bullet_sq.png
/usr/share/doc/qt/qtgui/images/coordinatesystem-analogclock.png
/usr/share/doc/qt/qtgui/images/coordinatesystem-line-antialias.png
/usr/share/doc/qt/qtgui/images/coordinatesystem-line-raster.png
/usr/share/doc/qt/qtgui/images/coordinatesystem-line.png
/usr/share/doc/qt/qtgui/images/coordinatesystem-rect-antialias.png
/usr/share/doc/qt/qtgui/images/coordinatesystem-rect-raster.png
/usr/share/doc/qt/qtgui/images/coordinatesystem-rect.png
/usr/share/doc/qt/qtgui/images/coordinatesystem-transformations.png
/usr/share/doc/qt/qtgui/images/cursor-arrow.png
/usr/share/doc/qt/qtgui/images/cursor-busy.png
/usr/share/doc/qt/qtgui/images/cursor-closedhand.png
/usr/share/doc/qt/qtgui/images/cursor-cross.png
/usr/share/doc/qt/qtgui/images/cursor-forbidden.png
/usr/share/doc/qt/qtgui/images/cursor-hand.png
/usr/share/doc/qt/qtgui/images/cursor-hsplit.png
/usr/share/doc/qt/qtgui/images/cursor-ibeam.png
/usr/share/doc/qt/qtgui/images/cursor-openhand.png
/usr/share/doc/qt/qtgui/images/cursor-sizeall.png
/usr/share/doc/qt/qtgui/images/cursor-sizeb.png
/usr/share/doc/qt/qtgui/images/cursor-sizef.png
/usr/share/doc/qt/qtgui/images/cursor-sizeh.png
/usr/share/doc/qt/qtgui/images/cursor-sizev.png
/usr/share/doc/qt/qtgui/images/cursor-uparrow.png
/usr/share/doc/qt/qtgui/images/cursor-vsplit.png
/usr/share/doc/qt/qtgui/images/cursor-wait.png
/usr/share/doc/qt/qtgui/images/cursor-whatsthis.png
/usr/share/doc/qt/qtgui/images/hellovulkancubes.png
/usr/share/doc/qt/qtgui/images/hellovulkantexture.png
/usr/share/doc/qt/qtgui/images/hellovulkantriangle.png
/usr/share/doc/qt/qtgui/images/hellovulkanwidget.png
/usr/share/doc/qt/qtgui/images/hellovulkanwindow.png
/usr/share/doc/qt/qtgui/images/home.png
/usr/share/doc/qt/qtgui/images/hoverevents.png
/usr/share/doc/qt/qtgui/images/ico_note.png
/usr/share/doc/qt/qtgui/images/ico_note_attention.png
/usr/share/doc/qt/qtgui/images/ico_out.png
/usr/share/doc/qt/qtgui/images/icon.png
/usr/share/doc/qt/qtgui/images/logo.png
/usr/share/doc/qt/qtgui/images/openglwindow-example.png
/usr/share/doc/qt/qtgui/images/paintsystem-antialiasing.png
/usr/share/doc/qt/qtgui/images/paintsystem-core.png
/usr/share/doc/qt/qtgui/images/paintsystem-fancygradient.png
/usr/share/doc/qt/qtgui/images/paintsystem-gradients.png
/usr/share/doc/qt/qtgui/images/paintsystem-movie.png
/usr/share/doc/qt/qtgui/images/paintsystem-painterpath.png
/usr/share/doc/qt/qtgui/images/palette.png
/usr/share/doc/qt/qtgui/images/plaintext-layout.png
/usr/share/doc/qt/qtgui/images/qcolor-cmyk.png
/usr/share/doc/qt/qtgui/images/qcolor-hsv.png
/usr/share/doc/qt/qtgui/images/qcolor-hue.png
/usr/share/doc/qt/qtgui/images/qcolor-rgb.png
/usr/share/doc/qt/qtgui/images/qcolor-saturation.png
/usr/share/doc/qt/qtgui/images/qcolor-value.png
/usr/share/doc/qt/qtgui/images/qconicalgradient.png
/usr/share/doc/qt/qtgui/images/qgradient-conical.png
/usr/share/doc/qt/qtgui/images/qgradient-linear.png
/usr/share/doc/qt/qtgui/images/qgradient-radial.png
/usr/share/doc/qt/qtgui/images/qimage-32bit_scaled.png
/usr/share/doc/qt/qtgui/images/qimage-8bit_scaled.png
/usr/share/doc/qt/qtgui/images/qimage-scaling.png
/usr/share/doc/qt/qtgui/images/qlineargradient-pad.png
/usr/share/doc/qt/qtgui/images/qlineargradient-reflect.png
/usr/share/doc/qt/qtgui/images/qlineargradient-repeat.png
/usr/share/doc/qt/qtgui/images/qmatrix-combinedtransformation.png
/usr/share/doc/qt/qtgui/images/qmatrix-representation.png
/usr/share/doc/qt/qtgui/images/qmatrix-simpletransformation.png
/usr/share/doc/qt/qtgui/images/qpainter-affinetransformations.png
/usr/share/doc/qt/qtgui/images/qpainter-arc.png
/usr/share/doc/qt/qtgui/images/qpainter-basicdrawing.png
/usr/share/doc/qt/qtgui/images/qpainter-chord.png
/usr/share/doc/qt/qtgui/images/qpainter-clock.png
/usr/share/doc/qt/qtgui/images/qpainter-compositiondemo.png
/usr/share/doc/qt/qtgui/images/qpainter-compositionmode1.png
/usr/share/doc/qt/qtgui/images/qpainter-compositionmode2.png
/usr/share/doc/qt/qtgui/images/qpainter-concentriccircles.png
/usr/share/doc/qt/qtgui/images/qpainter-ellipse.png
/usr/share/doc/qt/qtgui/images/qpainter-gradients.png
/usr/share/doc/qt/qtgui/images/qpainter-line.png
/usr/share/doc/qt/qtgui/images/qpainter-painterpaths.png
/usr/share/doc/qt/qtgui/images/qpainter-path.png
/usr/share/doc/qt/qtgui/images/qpainter-pathstroking.png
/usr/share/doc/qt/qtgui/images/qpainter-pie.png
/usr/share/doc/qt/qtgui/images/qpainter-polygon.png
/usr/share/doc/qt/qtgui/images/qpainter-rectangle.png
/usr/share/doc/qt/qtgui/images/qpainter-rotation.png
/usr/share/doc/qt/qtgui/images/qpainter-roundrect.png
/usr/share/doc/qt/qtgui/images/qpainter-scale.png
/usr/share/doc/qt/qtgui/images/qpainter-text-bounds.png
/usr/share/doc/qt/qtgui/images/qpainter-text.png
/usr/share/doc/qt/qtgui/images/qpainter-translation.png
/usr/share/doc/qt/qtgui/images/qpainter-vectordeformation.png
/usr/share/doc/qt/qtgui/images/qpainterpath-addellipse.png
/usr/share/doc/qt/qtgui/images/qpainterpath-addpolygon.png
/usr/share/doc/qt/qtgui/images/qpainterpath-addrectangle.png
/usr/share/doc/qt/qtgui/images/qpainterpath-addtext.png
/usr/share/doc/qt/qtgui/images/qpainterpath-arcto.png
/usr/share/doc/qt/qtgui/images/qpainterpath-construction.png
/usr/share/doc/qt/qtgui/images/qpainterpath-cubicto.png
/usr/share/doc/qt/qtgui/images/qpainterpath-demo.png
/usr/share/doc/qt/qtgui/images/qpainterpath-example.png
/usr/share/doc/qt/qtgui/images/qpen-bevel.png
/usr/share/doc/qt/qtgui/images/qpen-custom.png
/usr/share/doc/qt/qtgui/images/qpen-dash.png
/usr/share/doc/qt/qtgui/images/qpen-dashdot.png
/usr/share/doc/qt/qtgui/images/qpen-dashdotdot.png
/usr/share/doc/qt/qtgui/images/qpen-dashpattern.png
/usr/share/doc/qt/qtgui/images/qpen-demo.png
/usr/share/doc/qt/qtgui/images/qpen-dot.png
/usr/share/doc/qt/qtgui/images/qpen-flat.png
/usr/share/doc/qt/qtgui/images/qpen-miter.png
/usr/share/doc/qt/qtgui/images/qpen-miterlimit.png
/usr/share/doc/qt/qtgui/images/qpen-roundcap.png
/usr/share/doc/qt/qtgui/images/qpen-roundjoin.png
/usr/share/doc/qt/qtgui/images/qpen-solid.png
/usr/share/doc/qt/qtgui/images/qpen-square.png
/usr/share/doc/qt/qtgui/images/qpixelformat-argb32buffer.png
/usr/share/doc/qt/qtgui/images/qradialgradient-pad.png
/usr/share/doc/qt/qtgui/images/qradialgradient-reflect.png
/usr/share/doc/qt/qtgui/images/qradialgradient-repeat.png
/usr/share/doc/qt/qtgui/images/qrect-diagram-zero.png
/usr/share/doc/qt/qtgui/images/qrectf-diagram-one.png
/usr/share/doc/qt/qtgui/images/qrectf-diagram-three.png
/usr/share/doc/qt/qtgui/images/qrectf-diagram-two.png
/usr/share/doc/qt/qtgui/images/qstatustipevent-action.png
/usr/share/doc/qt/qtgui/images/qstatustipevent-widget.png
/usr/share/doc/qt/qtgui/images/qt-colors.png
/usr/share/doc/qt/qtgui/images/qt-fillrule-oddeven.png
/usr/share/doc/qt/qtgui/images/qt-fillrule-winding.png
/usr/share/doc/qt/qtgui/images/qtabletevent-tilt.png
/usr/share/doc/qt/qtgui/images/qtextblock-sequence.png
/usr/share/doc/qt/qtgui/images/qtextfragment-split.png
/usr/share/doc/qt/qtgui/images/qtextframe-style.png
/usr/share/doc/qt/qtgui/images/qtexttableformat-cell.png
/usr/share/doc/qt/qtgui/images/qtransform-combinedtransformation.png
/usr/share/doc/qt/qtgui/images/qtransform-combinedtransformation2.png
/usr/share/doc/qt/qtgui/images/qtransform-representation.png
/usr/share/doc/qt/qtgui/images/qtransform-simpletransformation.png
/usr/share/doc/qt/qtgui/images/richtext-document.png
/usr/share/doc/qt/qtgui/images/rintersect.png
/usr/share/doc/qt/qtgui/images/rsubtract.png
/usr/share/doc/qt/qtgui/images/runion.png
/usr/share/doc/qt/qtgui/images/rxor.png
/usr/share/doc/qt/qtgui/images/texttable-merge.png
/usr/share/doc/qt/qtgui/images/texttable-split.png
/usr/share/doc/qt/qtgui/images/touchpoint-metrics.png
/usr/share/doc/qt/qtgui/style/offline-simple.css
/usr/share/doc/qt/qtgui/style/offline.css
/usr/share/doc/qt/qthelp/examples-manifest.xml
/usr/share/doc/qt/qthelp/examples-qthelp.html
/usr/share/doc/qt/qthelp/helpsystem.html
/usr/share/doc/qt/qthelp/qcompressedhelpinfo-members.html
/usr/share/doc/qt/qthelp/qcompressedhelpinfo.html
/usr/share/doc/qt/qthelp/qhelpcontentitem-members.html
/usr/share/doc/qt/qthelp/qhelpcontentitem.html
/usr/share/doc/qt/qthelp/qhelpcontentmodel-members.html
/usr/share/doc/qt/qthelp/qhelpcontentmodel.html
/usr/share/doc/qt/qthelp/qhelpcontentwidget-members.html
/usr/share/doc/qt/qthelp/qhelpcontentwidget.html
/usr/share/doc/qt/qthelp/qhelpengine-members.html
/usr/share/doc/qt/qthelp/qhelpengine.html
/usr/share/doc/qt/qthelp/qhelpenginecore-members.html
/usr/share/doc/qt/qthelp/qhelpenginecore-obsolete.html
/usr/share/doc/qt/qthelp/qhelpenginecore.html
/usr/share/doc/qt/qthelp/qhelpfilterdata-members.html
/usr/share/doc/qt/qthelp/qhelpfilterdata.html
/usr/share/doc/qt/qthelp/qhelpfilterengine-members.html
/usr/share/doc/qt/qthelp/qhelpfilterengine.html
/usr/share/doc/qt/qthelp/qhelpindexmodel-members.html
/usr/share/doc/qt/qthelp/qhelpindexmodel-obsolete.html
/usr/share/doc/qt/qthelp/qhelpindexmodel.html
/usr/share/doc/qt/qthelp/qhelpindexwidget-members.html
/usr/share/doc/qt/qthelp/qhelpindexwidget.html
/usr/share/doc/qt/qthelp/qhelpsearchengine-members.html
/usr/share/doc/qt/qthelp/qhelpsearchengine-obsolete.html
/usr/share/doc/qt/qthelp/qhelpsearchengine.html
/usr/share/doc/qt/qthelp/qhelpsearchquery-members.html
/usr/share/doc/qt/qthelp/qhelpsearchquery.html
/usr/share/doc/qt/qthelp/qhelpsearchquerywidget-members.html
/usr/share/doc/qt/qthelp/qhelpsearchquerywidget-obsolete.html
/usr/share/doc/qt/qthelp/qhelpsearchquerywidget.html
/usr/share/doc/qt/qthelp/qhelpsearchresult-members.html
/usr/share/doc/qt/qthelp/qhelpsearchresult.html
/usr/share/doc/qt/qthelp/qhelpsearchresultwidget-members.html
/usr/share/doc/qt/qthelp/qhelpsearchresultwidget.html
/usr/share/doc/qt/qthelp/qthelp-contextsensitivehelp-example.html
/usr/share/doc/qt/qthelp/qthelp-framework.html
/usr/share/doc/qt/qthelp/qthelp-index.html
/usr/share/doc/qt/qthelp/qthelp-module.html
/usr/share/doc/qt/qthelp/qthelp.index
/usr/share/doc/qt/qthelp/qthelp.qhp
/usr/share/doc/qt/qthelp/qthelp.qhp.sha1
/usr/share/doc/qt/qthelp/qthelpproject.html
/usr/share/doc/qt/qthelp/images/arrow_bc.png
/usr/share/doc/qt/qthelp/images/bgrContent.png
/usr/share/doc/qt/qthelp/images/btn_next.png
/usr/share/doc/qt/qthelp/images/btn_prev.png
/usr/share/doc/qt/qthelp/images/bullet_dn.png
/usr/share/doc/qt/qthelp/images/bullet_sq.png
/usr/share/doc/qt/qthelp/images/home.png
/usr/share/doc/qt/qthelp/images/ico_note.png
/usr/share/doc/qt/qthelp/images/ico_note_attention.png
/usr/share/doc/qt/qthelp/images/ico_out.png
/usr/share/doc/qt/qthelp/images/logo.png
/usr/share/doc/qt/qthelp/style/offline-simple.css
/usr/share/doc/qt/qthelp/style/offline.css
/usr/share/doc/qt/qtimageformats/qtimageformats-attribution-libtiff.html
/usr/share/doc/qt/qtimageformats/qtimageformats-attribution-libwebp.html
/usr/share/doc/qt/qtimageformats/qtimageformats-index.html
/usr/share/doc/qt/qtimageformats/qtimageformats.index
/usr/share/doc/qt/qtimageformats/qtimageformats.qhp
/usr/share/doc/qt/qtimageformats/qtimageformats.qhp.sha1
/usr/share/doc/qt/qtimageformats/images/arrow_bc.png
/usr/share/doc/qt/qtimageformats/images/bgrContent.png
/usr/share/doc/qt/qtimageformats/images/btn_next.png
/usr/share/doc/qt/qtimageformats/images/btn_prev.png
/usr/share/doc/qt/qtimageformats/images/bullet_dn.png
/usr/share/doc/qt/qtimageformats/images/bullet_sq.png
/usr/share/doc/qt/qtimageformats/images/home.png
/usr/share/doc/qt/qtimageformats/images/ico_note.png
/usr/share/doc/qt/qtimageformats/images/ico_note_attention.png
/usr/share/doc/qt/qtimageformats/images/ico_out.png
/usr/share/doc/qt/qtimageformats/images/logo.png
/usr/share/doc/qt/qtimageformats/style/offline-simple.css
/usr/share/doc/qt/qtimageformats/style/offline.css
/usr/share/doc/qt/qtlabscalendar/qml-qt-labs-calendar-calendar-members.html
/usr/share/doc/qt/qtlabscalendar/qml-qt-labs-calendar-calendar.html
/usr/share/doc/qt/qtlabscalendar/qml-qt-labs-calendar-calendarmodel-members.html
/usr/share/doc/qt/qtlabscalendar/qml-qt-labs-calendar-calendarmodel.html
/usr/share/doc/qt/qtlabscalendar/qml-qt-labs-calendar-dayofweekrow-members.html
/usr/share/doc/qt/qtlabscalendar/qml-qt-labs-calendar-dayofweekrow.html
/usr/share/doc/qt/qtlabscalendar/qml-qt-labs-calendar-monthgrid-members.html
/usr/share/doc/qt/qtlabscalendar/qml-qt-labs-calendar-monthgrid.html
/usr/share/doc/qt/qtlabscalendar/qml-qt-labs-calendar-weeknumbercolumn-members.html
/usr/share/doc/qt/qtlabscalendar/qml-qt-labs-calendar-weeknumbercolumn.html
/usr/share/doc/qt/qtlabscalendar/qt-labs-calendar-qmlmodule.html
/usr/share/doc/qt/qtlabscalendar/qtlabscalendar-index.html
/usr/share/doc/qt/qtlabscalendar/qtlabscalendar.index
/usr/share/doc/qt/qtlabscalendar/qtlabscalendar.qhp
/usr/share/doc/qt/qtlabscalendar/qtlabscalendar.qhp.sha1
/usr/share/doc/qt/qtlabscalendar/qtlabscalendar.tags
/usr/share/doc/qt/qtlabscalendar/images/arrow_bc.png
/usr/share/doc/qt/qtlabscalendar/images/bgrContent.png
/usr/share/doc/qt/qtlabscalendar/images/btn_next.png
/usr/share/doc/qt/qtlabscalendar/images/btn_prev.png
/usr/share/doc/qt/qtlabscalendar/images/bullet_dn.png
/usr/share/doc/qt/qtlabscalendar/images/bullet_sq.png
/usr/share/doc/qt/qtlabscalendar/images/home.png
/usr/share/doc/qt/qtlabscalendar/images/ico_note.png
/usr/share/doc/qt/qtlabscalendar/images/ico_note_attention.png
/usr/share/doc/qt/qtlabscalendar/images/ico_out.png
/usr/share/doc/qt/qtlabscalendar/images/logo.png
/usr/share/doc/qt/qtlabscalendar/images/qtlabscalendar-dayofweekrow-layout.png
/usr/share/doc/qt/qtlabscalendar/images/qtlabscalendar-dayofweekrow.png
/usr/share/doc/qt/qtlabscalendar/images/qtlabscalendar-monthgrid-layout.png
/usr/share/doc/qt/qtlabscalendar/images/qtlabscalendar-monthgrid.png
/usr/share/doc/qt/qtlabscalendar/images/qtlabscalendar-weeknumbercolumn-layout.png
/usr/share/doc/qt/qtlabscalendar/images/qtlabscalendar-weeknumbercolumn.png
/usr/share/doc/qt/qtlabscalendar/style/offline-simple.css
/usr/share/doc/qt/qtlabscalendar/style/offline.css
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-colordialog-members.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-colordialog.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-dialog-members.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-dialog.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-filedialog-members.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-filedialog.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-folderdialog-members.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-folderdialog.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-fontdialog-members.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-fontdialog.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-menu-members.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-menu-obsolete.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-menu.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-menubar-members.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-menubar.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-menuitem-members.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-menuitem-obsolete.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-menuitem.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-menuitemgroup-members.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-menuitemgroup.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-menuseparator-members.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-menuseparator.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-messagedialog-members.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-messagedialog.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-standardpaths-members.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-standardpaths.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-systemtrayicon-members.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-systemtrayicon-obsolete.html
/usr/share/doc/qt/qtlabsplatform/qml-qt-labs-platform-systemtrayicon.html
/usr/share/doc/qt/qtlabsplatform/qt-labs-platform-qmlmodule.html
/usr/share/doc/qt/qtlabsplatform/qtlabsplatform-index.html
/usr/share/doc/qt/qtlabsplatform/qtlabsplatform.index
/usr/share/doc/qt/qtlabsplatform/qtlabsplatform.qhp
/usr/share/doc/qt/qtlabsplatform/qtlabsplatform.qhp.sha1
/usr/share/doc/qt/qtlabsplatform/qtlabsplatform.tags
/usr/share/doc/qt/qtlabsplatform/images/arrow_bc.png
/usr/share/doc/qt/qtlabsplatform/images/bgrContent.png
/usr/share/doc/qt/qtlabsplatform/images/btn_next.png
/usr/share/doc/qt/qtlabsplatform/images/btn_prev.png
/usr/share/doc/qt/qtlabsplatform/images/bullet_dn.png
/usr/share/doc/qt/qtlabsplatform/images/bullet_sq.png
/usr/share/doc/qt/qtlabsplatform/images/home.png
/usr/share/doc/qt/qtlabsplatform/images/ico_note.png
/usr/share/doc/qt/qtlabsplatform/images/ico_note_attention.png
/usr/share/doc/qt/qtlabsplatform/images/ico_out.png
/usr/share/doc/qt/qtlabsplatform/images/logo.png
/usr/share/doc/qt/qtlabsplatform/images/qtlabsplatform-colordialog-gtk.png
/usr/share/doc/qt/qtlabsplatform/images/qtlabsplatform-filedialog-gtk.png
/usr/share/doc/qt/qtlabsplatform/images/qtlabsplatform-folderdialog-gtk.png
/usr/share/doc/qt/qtlabsplatform/images/qtlabsplatform-fontdialog-gtk.png
/usr/share/doc/qt/qtlabsplatform/images/qtlabsplatform-menu.png
/usr/share/doc/qt/qtlabsplatform/images/qtlabsplatform-menubar.png
/usr/share/doc/qt/qtlabsplatform/images/qtlabsplatform-messagedialog-android.png
/usr/share/doc/qt/qtlabsplatform/images/qtlabsplatform-messagedialog-informative-android.png
/usr/share/doc/qt/qtlabsplatform/images/qtlabsplatform-systemtrayicon-menu.png
/usr/share/doc/qt/qtlabsplatform/images/qtlabsplatform-systemtrayicon-message.png
/usr/share/doc/qt/qtlabsplatform/images/qtlabsplatform-systemtrayicon.png
/usr/share/doc/qt/qtlabsplatform/style/offline-simple.css
/usr/share/doc/qt/qtlabsplatform/style/offline.css
/usr/share/doc/qt/qtlinguist/examples-linguist.html
/usr/share/doc/qt/qtlinguist/examples-manifest.xml
/usr/share/doc/qt/qtlinguist/linguist-id-based-i18n.html
/usr/share/doc/qt/qtlinguist/linguist-manager.html
/usr/share/doc/qt/qtlinguist/linguist-overview.html
/usr/share/doc/qt/qtlinguist/linguist-programmers.html
/usr/share/doc/qt/qtlinguist/linguist-translators.html
/usr/share/doc/qt/qtlinguist/linguist-ts-file-format.html
/usr/share/doc/qt/qtlinguist/qtlinguist-arrowpad-example.html
/usr/share/doc/qt/qtlinguist/qtlinguist-cmake-qt5-add-translation.html
/usr/share/doc/qt/qtlinguist/qtlinguist-cmake-qt5-create-translation.html
/usr/share/doc/qt/qtlinguist/qtlinguist-hellotr-example.html
/usr/share/doc/qt/qtlinguist/qtlinguist-index.html
/usr/share/doc/qt/qtlinguist/qtlinguist-trollprint-example.html
/usr/share/doc/qt/qtlinguist/qtlinguist.index
/usr/share/doc/qt/qtlinguist/qtlinguist.qhp
/usr/share/doc/qt/qtlinguist/qtlinguist.qhp.sha1
/usr/share/doc/qt/qtlinguist/images/arrow_bc.png
/usr/share/doc/qt/qtlinguist/images/bgrContent.png
/usr/share/doc/qt/qtlinguist/images/btn_next.png
/usr/share/doc/qt/qtlinguist/images/btn_prev.png
/usr/share/doc/qt/qtlinguist/images/bullet_dn.png
/usr/share/doc/qt/qtlinguist/images/bullet_sq.png
/usr/share/doc/qt/qtlinguist/images/home.png
/usr/share/doc/qt/qtlinguist/images/ico_note.png
/usr/share/doc/qt/qtlinguist/images/ico_note_attention.png
/usr/share/doc/qt/qtlinguist/images/ico_out.png
/usr/share/doc/qt/qtlinguist/images/linguist-arrowpad_en.png
/usr/share/doc/qt/qtlinguist/images/linguist-arrowpad_fr.png
/usr/share/doc/qt/qtlinguist/images/linguist-arrowpad_nl.png
/usr/share/doc/qt/qtlinguist/images/linguist-batchtranslation.png
/usr/share/doc/qt/qtlinguist/images/linguist-check-empty.png
/usr/share/doc/qt/qtlinguist/images/linguist-check-obsolete.png
/usr/share/doc/qt/qtlinguist/images/linguist-check-off.png
/usr/share/doc/qt/qtlinguist/images/linguist-check-on.png
/usr/share/doc/qt/qtlinguist/images/linguist-check-warning.png
/usr/share/doc/qt/qtlinguist/images/linguist-danger.png
/usr/share/doc/qt/qtlinguist/images/linguist-doneandnext.png
/usr/share/doc/qt/qtlinguist/images/linguist-hellotr_en.png
/usr/share/doc/qt/qtlinguist/images/linguist-hellotr_la.png
/usr/share/doc/qt/qtlinguist/images/linguist-linguist.png
/usr/share/doc/qt/qtlinguist/images/linguist-linguist_2.png
/usr/share/doc/qt/qtlinguist/images/linguist-phrasebookdialog.png
/usr/share/doc/qt/qtlinguist/images/linguist-translationfilesettings.png
/usr/share/doc/qt/qtlinguist/images/linguist-trollprint_10_en.png
/usr/share/doc/qt/qtlinguist/images/linguist-trollprint_10_pt_bad.png
/usr/share/doc/qt/qtlinguist/images/linguist-trollprint_10_pt_good.png
/usr/share/doc/qt/qtlinguist/images/linguist-trollprint_11_en.png
/usr/share/doc/qt/qtlinguist/images/linguist-trollprint_11_pt.png
/usr/share/doc/qt/qtlinguist/images/logo.png
/usr/share/doc/qt/qtlinguist/style/offline-simple.css
/usr/share/doc/qt/qtlinguist/style/offline.css
/usr/share/doc/qt/qtlocation/examples-manifest.xml
/usr/share/doc/qt/qtlocation/location-cpp-qml.html
/usr/share/doc/qt/qtlocation/location-maps-cpp.html
/usr/share/doc/qt/qtlocation/location-maps-qml.html
/usr/share/doc/qt/qtlocation/location-places-backend.html
/usr/share/doc/qt/qtlocation/location-places-cpp.html
/usr/share/doc/qt/qtlocation/location-places-qml.html
/usr/share/doc/qt/qtlocation/location-plugin-esri.html
/usr/share/doc/qt/qtlocation/location-plugin-here.html
/usr/share/doc/qt/qtlocation/location-plugin-itemsoverlay.html
/usr/share/doc/qt/qtlocation/location-plugin-mapbox.html
/usr/share/doc/qt/qtlocation/location-plugin-mapboxgl.html
/usr/share/doc/qt/qtlocation/location-plugin-osm.html
/usr/share/doc/qt/qtlocation/qgeocodereply-members.html
/usr/share/doc/qt/qtlocation/qgeocodereply.html
/usr/share/doc/qt/qtlocation/qgeocodingmanager-members.html
/usr/share/doc/qt/qtlocation/qgeocodingmanager.html
/usr/share/doc/qt/qtlocation/qgeocodingmanagerengine-members.html
/usr/share/doc/qt/qtlocation/qgeocodingmanagerengine.html
/usr/share/doc/qt/qtlocation/qgeojson-members.html
/usr/share/doc/qt/qtlocation/qgeojson.html
/usr/share/doc/qt/qtlocation/qgeomaneuver-members.html
/usr/share/doc/qt/qtlocation/qgeomaneuver.html
/usr/share/doc/qt/qtlocation/qgeoroute-members.html
/usr/share/doc/qt/qtlocation/qgeoroute.html
/usr/share/doc/qt/qtlocation/qgeorouteleg-members.html
/usr/share/doc/qt/qtlocation/qgeorouteleg.html
/usr/share/doc/qt/qtlocation/qgeoroutereply-members.html
/usr/share/doc/qt/qtlocation/qgeoroutereply.html
/usr/share/doc/qt/qtlocation/qgeorouterequest-members.html
/usr/share/doc/qt/qtlocation/qgeorouterequest.html
/usr/share/doc/qt/qtlocation/qgeoroutesegment-members.html
/usr/share/doc/qt/qtlocation/qgeoroutesegment.html
/usr/share/doc/qt/qtlocation/qgeoroutingmanager-members.html
/usr/share/doc/qt/qtlocation/qgeoroutingmanager.html
/usr/share/doc/qt/qtlocation/qgeoroutingmanagerengine-members.html
/usr/share/doc/qt/qtlocation/qgeoroutingmanagerengine.html
/usr/share/doc/qt/qtlocation/qgeoserviceprovider-members.html
/usr/share/doc/qt/qtlocation/qgeoserviceprovider.html
/usr/share/doc/qt/qtlocation/qgeoserviceproviderfactory-members.html
/usr/share/doc/qt/qtlocation/qgeoserviceproviderfactory.html
/usr/share/doc/qt/qtlocation/qgeoserviceproviderfactoryv2-members.html
/usr/share/doc/qt/qtlocation/qgeoserviceproviderfactoryv2.html
/usr/share/doc/qt/qtlocation/qlocation.html
/usr/share/doc/qt/qtlocation/qml-location5-maps.html
/usr/share/doc/qt/qtlocation/qml-qt-labs-location-mapcircleobject-members.html
/usr/share/doc/qt/qtlocation/qml-qt-labs-location-mapcircleobject.html
/usr/share/doc/qt/qtlocation/qml-qt-labs-location-mapiconobject-members.html
/usr/share/doc/qt/qtlocation/qml-qt-labs-location-mapiconobject.html
/usr/share/doc/qt/qtlocation/qml-qt-labs-location-mapobjectview-members.html
/usr/share/doc/qt/qtlocation/qml-qt-labs-location-mapobjectview.html
/usr/share/doc/qt/qtlocation/qml-qt-labs-location-mappolygonobject-members.html
/usr/share/doc/qt/qtlocation/qml-qt-labs-location-mappolygonobject.html
/usr/share/doc/qt/qtlocation/qml-qt-labs-location-mappolylineobject-members.html
/usr/share/doc/qt/qtlocation/qml-qt-labs-location-mappolylineobject.html
/usr/share/doc/qt/qtlocation/qml-qt-labs-location-maprouteobject-members.html
/usr/share/doc/qt/qtlocation/qml-qt-labs-location-maprouteobject.html
/usr/share/doc/qt/qtlocation/qml-qt-labs-location-navigator-members.html
/usr/share/doc/qt/qtlocation/qml-qt-labs-location-navigator.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-cameracapabilities-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-cameracapabilities.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-category-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-category.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-categorymodel-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-categorymodel.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-contactdetail-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-contactdetail.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-contactdetails-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-contactdetails.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-dynamicparameter-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-dynamicparameter.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-editorialmodel-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-editorialmodel.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-extendedattributes-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-extendedattributes.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-geocodemodel-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-geocodemodel.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-icon-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-icon.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-imagemodel-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-imagemodel.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-map-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-map.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-mapcircle-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-mapcircle.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-mapcopyrightnotice-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-mapcopyrightnotice.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-mapgesturearea-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-mapgesturearea.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-mapitemgroup-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-mapitemgroup.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-mapitemview-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-mapitemview.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-mapparameter-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-mapparameter.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-mappinchevent-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-mappinchevent.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-mappolygon-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-mappolygon.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-mappolyline-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-mappolyline.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-mapquickitem-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-mapquickitem.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-maprectangle-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-maprectangle.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-maproute-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-maproute.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-maptype-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-maptype.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-place-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-place.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-placeattribute-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-placeattribute.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-placesearchmodel-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-placesearchmodel.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-placesearchsuggestionmodel-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-placesearchsuggestionmodel.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-plugin-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-plugin.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-pluginparameter-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-pluginparameter.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-ratings-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-ratings.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-reviewmodel-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-reviewmodel.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-route-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-route.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-routeleg-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-routeleg.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-routemaneuver-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-routemaneuver.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-routemodel-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-routemodel.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-routequery-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-routequery.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-routesegment-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-routesegment.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-supplier-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-supplier.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-user-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-user.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-waypoint-members.html
/usr/share/doc/qt/qtlocation/qml-qtlocation-waypoint.html
/usr/share/doc/qt/qtlocation/qml-qtlocation5-maps.html
/usr/share/doc/qt/qtlocation/qplace-members.html
/usr/share/doc/qt/qtlocation/qplace.html
/usr/share/doc/qt/qtlocation/qplaceattribute-members.html
/usr/share/doc/qt/qtlocation/qplaceattribute.html
/usr/share/doc/qt/qtlocation/qplacecategory-members.html
/usr/share/doc/qt/qtlocation/qplacecategory.html
/usr/share/doc/qt/qtlocation/qplacecontactdetail-members.html
/usr/share/doc/qt/qtlocation/qplacecontactdetail.html
/usr/share/doc/qt/qtlocation/qplacecontent-members.html
/usr/share/doc/qt/qtlocation/qplacecontent.html
/usr/share/doc/qt/qtlocation/qplacecontentreply-members.html
/usr/share/doc/qt/qtlocation/qplacecontentreply.html
/usr/share/doc/qt/qtlocation/qplacecontentrequest-members.html
/usr/share/doc/qt/qtlocation/qplacecontentrequest.html
/usr/share/doc/qt/qtlocation/qplacedetailsreply-members.html
/usr/share/doc/qt/qtlocation/qplacedetailsreply.html
/usr/share/doc/qt/qtlocation/qplaceeditorial-members.html
/usr/share/doc/qt/qtlocation/qplaceeditorial.html
/usr/share/doc/qt/qtlocation/qplaceicon-members.html
/usr/share/doc/qt/qtlocation/qplaceicon.html
/usr/share/doc/qt/qtlocation/qplaceidreply-members.html
/usr/share/doc/qt/qtlocation/qplaceidreply.html
/usr/share/doc/qt/qtlocation/qplaceimage-members.html
/usr/share/doc/qt/qtlocation/qplaceimage.html
/usr/share/doc/qt/qtlocation/qplacemanager-members.html
/usr/share/doc/qt/qtlocation/qplacemanager.html
/usr/share/doc/qt/qtlocation/qplacemanagerengine-members.html
/usr/share/doc/qt/qtlocation/qplacemanagerengine.html
/usr/share/doc/qt/qtlocation/qplacematchreply-members.html
/usr/share/doc/qt/qtlocation/qplacematchreply.html
/usr/share/doc/qt/qtlocation/qplacematchrequest-members.html
/usr/share/doc/qt/qtlocation/qplacematchrequest.html
/usr/share/doc/qt/qtlocation/qplaceproposedsearchresult-members.html
/usr/share/doc/qt/qtlocation/qplaceproposedsearchresult.html
/usr/share/doc/qt/qtlocation/qplaceratings-members.html
/usr/share/doc/qt/qtlocation/qplaceratings.html
/usr/share/doc/qt/qtlocation/qplacereply-members.html
/usr/share/doc/qt/qtlocation/qplacereply.html
/usr/share/doc/qt/qtlocation/qplaceresult-members.html
/usr/share/doc/qt/qtlocation/qplaceresult.html
/usr/share/doc/qt/qtlocation/qplacereview-members.html
/usr/share/doc/qt/qtlocation/qplacereview.html
/usr/share/doc/qt/qtlocation/qplacesearchreply-members.html
/usr/share/doc/qt/qtlocation/qplacesearchreply.html
/usr/share/doc/qt/qtlocation/qplacesearchrequest-members.html
/usr/share/doc/qt/qtlocation/qplacesearchrequest.html
/usr/share/doc/qt/qtlocation/qplacesearchresult-members.html
/usr/share/doc/qt/qtlocation/qplacesearchresult.html
/usr/share/doc/qt/qtlocation/qplacesearchsuggestionreply-members.html
/usr/share/doc/qt/qtlocation/qplacesearchsuggestionreply.html
/usr/share/doc/qt/qtlocation/qplacesupplier-members.html
/usr/share/doc/qt/qtlocation/qplacesupplier.html
/usr/share/doc/qt/qtlocation/qplaceuser-members.html
/usr/share/doc/qt/qtlocation/qplaceuser.html
/usr/share/doc/qt/qtlocation/qt-labs-location-qmlmodule.html
/usr/share/doc/qt/qtlocation/qtlocation-attribution-clip2tri.html
/usr/share/doc/qt/qtlocation/qtlocation-attribution-clipper.html
/usr/share/doc/qt/qtlocation/qtlocation-attribution-earcut.html
/usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-boost.html
/usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-css-color-parser.html
/usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-earcut.html
/usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-geojson.html
/usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-geojsonvt.html
/usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-geometry.html
/usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-kdbush.html
/usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-libcxx.html
/usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-nunicode.html
/usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-parsedate.html
/usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-polylabel.html
/usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-protozero.html
/usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-rapidjson.html
/usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-shelfpack.html
/usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-supercluster.html
/usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-tao-tuple.html
/usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-unique-resource.html
/usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-variant.html
/usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-vectortile.html
/usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl-wagyu.html
/usr/share/doc/qt/qtlocation/qtlocation-attribution-mapboxgl.html
/usr/share/doc/qt/qtlocation/qtlocation-attribution-poly2tri.html
/usr/share/doc/qt/qtlocation/qtlocation-changes.html
/usr/share/doc/qt/qtlocation/qtlocation-cpp.html
/usr/share/doc/qt/qtlocation/qtlocation-examples.html
/usr/share/doc/qt/qtlocation/qtlocation-geoservices.html
/usr/share/doc/qt/qtlocation/qtlocation-index.html
/usr/share/doc/qt/qtlocation/qtlocation-itemview-transitions-example.html
/usr/share/doc/qt/qtlocation/qtlocation-mapviewer-example.html
/usr/share/doc/qt/qtlocation/qtlocation-minimal-map-example.html
/usr/share/doc/qt/qtlocation/qtlocation-module.html
/usr/share/doc/qt/qtlocation/qtlocation-places-example.html
/usr/share/doc/qt/qtlocation/qtlocation-places-list-example.html
/usr/share/doc/qt/qtlocation/qtlocation-places-map-example.html
/usr/share/doc/qt/qtlocation/qtlocation-planespotter-example.html
/usr/share/doc/qt/qtlocation/qtlocation-qmlmodule.html
/usr/share/doc/qt/qtlocation/qtlocation.index
/usr/share/doc/qt/qtlocation/qtlocation.qhp
/usr/share/doc/qt/qtlocation/qtlocation.qhp.sha1
/usr/share/doc/qt/qtlocation/qtlocation.tags
/usr/share/doc/qt/qtlocation/images/api-mapcircle.png
/usr/share/doc/qt/qtlocation/images/api-mapitemgroup.png
/usr/share/doc/qt/qtlocation/images/api-mappolygon.png
/usr/share/doc/qt/qtlocation/images/api-mappolyline.png
/usr/share/doc/qt/qtlocation/images/api-mapquickitem-anchor.png
/usr/share/doc/qt/qtlocation/images/api-mapquickitem.png
/usr/share/doc/qt/qtlocation/images/api-maprectangle.png
/usr/share/doc/qt/qtlocation/images/arrow_bc.png
/usr/share/doc/qt/qtlocation/images/bgrContent.png
/usr/share/doc/qt/qtlocation/images/btn_next.png
/usr/share/doc/qt/qtlocation/images/btn_prev.png
/usr/share/doc/qt/qtlocation/images/bullet_dn.png
/usr/share/doc/qt/qtlocation/images/bullet_sq.png
/usr/share/doc/qt/qtlocation/images/home.png
/usr/share/doc/qt/qtlocation/images/ico_note.png
/usr/share/doc/qt/qtlocation/images/ico_note_attention.png
/usr/share/doc/qt/qtlocation/images/ico_out.png
/usr/share/doc/qt/qtlocation/images/itemview_transitions.jpg
/usr/share/doc/qt/qtlocation/images/logo.png
/usr/share/doc/qt/qtlocation/images/mapviewer.png
/usr/share/doc/qt/qtlocation/images/minimal_map.png
/usr/share/doc/qt/qtlocation/images/places.png
/usr/share/doc/qt/qtlocation/images/places_list.png
/usr/share/doc/qt/qtlocation/images/places_map.png
/usr/share/doc/qt/qtlocation/images/planespotter.png
/usr/share/doc/qt/qtlocation/style/offline-simple.css
/usr/share/doc/qt/qtlocation/style/offline.css
/usr/share/doc/qt/qtlottieanimation/qml-qt-labs-lottieqt-lottieanimation-members.html
/usr/share/doc/qt/qtlottieanimation/qml-qt-labs-lottieqt-lottieanimation.html
/usr/share/doc/qt/qtlottieanimation/qt-labs-lottieqt-qmlmodule.html
/usr/share/doc/qt/qtlottieanimation/qtlottieanimation-index.html
/usr/share/doc/qt/qtlottieanimation/qtlottieanimation.index
/usr/share/doc/qt/qtlottieanimation/qtlottieanimation.qhp
/usr/share/doc/qt/qtlottieanimation/qtlottieanimation.qhp.sha1
/usr/share/doc/qt/qtlottieanimation/qtlottieanimation.tags
/usr/share/doc/qt/qtlottieanimation/images/arrow_bc.png
/usr/share/doc/qt/qtlottieanimation/images/bgrContent.png
/usr/share/doc/qt/qtlottieanimation/images/btn_next.png
/usr/share/doc/qt/qtlottieanimation/images/btn_prev.png
/usr/share/doc/qt/qtlottieanimation/images/bullet_dn.png
/usr/share/doc/qt/qtlottieanimation/images/bullet_sq.png
/usr/share/doc/qt/qtlottieanimation/images/home.png
/usr/share/doc/qt/qtlottieanimation/images/ico_note.png
/usr/share/doc/qt/qtlottieanimation/images/ico_note_attention.png
/usr/share/doc/qt/qtlottieanimation/images/ico_out.png
/usr/share/doc/qt/qtlottieanimation/images/logo.png
/usr/share/doc/qt/qtlottieanimation/style/offline-simple.css
/usr/share/doc/qt/qtlottieanimation/style/offline.css
/usr/share/doc/qt/qtmacextras/examples-manifest.xml
/usr/share/doc/qt/qtmacextras/examples-qtmacextras.html
/usr/share/doc/qt/qtmacextras/qmacpasteboardmime-members.html
/usr/share/doc/qt/qtmacextras/qmacpasteboardmime.html
/usr/share/doc/qt/qtmacextras/qmactoolbar-members.html
/usr/share/doc/qt/qtmacextras/qmactoolbar.html
/usr/share/doc/qt/qtmacextras/qmactoolbaritem-members.html
/usr/share/doc/qt/qtmacextras/qmactoolbaritem.html
/usr/share/doc/qt/qtmacextras/qtmac-obsolete.html
/usr/share/doc/qt/qtmacextras/qtmac.html
/usr/share/doc/qt/qtmacextras/qtmacextras-embeddedqwindow-example.html
/usr/share/doc/qt/qtmacextras/qtmacextras-index.html
/usr/share/doc/qt/qtmacextras/qtmacextras-macfunctions-example.html
/usr/share/doc/qt/qtmacextras/qtmacextras-macpasteboardmime-example.html
/usr/share/doc/qt/qtmacextras/qtmacextras-module.html
/usr/share/doc/qt/qtmacextras/qtmacextras.index
/usr/share/doc/qt/qtmacextras/qtmacextras.qhp
/usr/share/doc/qt/qtmacextras/qtmacextras.qhp.sha1
/usr/share/doc/qt/qtmacextras/images/arrow_bc.png
/usr/share/doc/qt/qtmacextras/images/bgrContent.png
/usr/share/doc/qt/qtmacextras/images/btn_next.png
/usr/share/doc/qt/qtmacextras/images/btn_prev.png
/usr/share/doc/qt/qtmacextras/images/bullet_dn.png
/usr/share/doc/qt/qtmacextras/images/bullet_sq.png
/usr/share/doc/qt/qtmacextras/images/home.png
/usr/share/doc/qt/qtmacextras/images/ico_note.png
/usr/share/doc/qt/qtmacextras/images/ico_note_attention.png
/usr/share/doc/qt/qtmacextras/images/ico_out.png
/usr/share/doc/qt/qtmacextras/images/logo.png
/usr/share/doc/qt/qtmacextras/style/offline-simple.css
/usr/share/doc/qt/qtmacextras/style/offline.css
/usr/share/doc/qt/qtmultimedia/audiooverview.html
/usr/share/doc/qt/qtmultimedia/cameraoverview.html
/usr/share/doc/qt/qtmultimedia/changes.html
/usr/share/doc/qt/qtmultimedia/examples-manifest.xml
/usr/share/doc/qt/qtmultimedia/multimedia-examples.html
/usr/share/doc/qt/qtmultimedia/multimediabackend.html
/usr/share/doc/qt/qtmultimedia/multimediaoverview.html
/usr/share/doc/qt/qtmultimedia/qabstractaudiodeviceinfo-members.html
/usr/share/doc/qt/qtmultimedia/qabstractaudiodeviceinfo.html
/usr/share/doc/qt/qtmultimedia/qabstractaudioinput-members.html
/usr/share/doc/qt/qtmultimedia/qabstractaudioinput.html
/usr/share/doc/qt/qtmultimedia/qabstractaudiooutput-members.html
/usr/share/doc/qt/qtmultimedia/qabstractaudiooutput.html
/usr/share/doc/qt/qtmultimedia/qabstractplanarvideobuffer-members.html
/usr/share/doc/qt/qtmultimedia/qabstractplanarvideobuffer.html
/usr/share/doc/qt/qtmultimedia/qabstractvideobuffer-members.html
/usr/share/doc/qt/qtmultimedia/qabstractvideobuffer.html
/usr/share/doc/qt/qtmultimedia/qabstractvideofilter-members.html
/usr/share/doc/qt/qtmultimedia/qabstractvideofilter.html
/usr/share/doc/qt/qtmultimedia/qabstractvideosurface-members.html
/usr/share/doc/qt/qtmultimedia/qabstractvideosurface.html
/usr/share/doc/qt/qtmultimedia/qaudio.html
/usr/share/doc/qt/qtmultimedia/qaudiobuffer-members.html
/usr/share/doc/qt/qtmultimedia/qaudiobuffer-stereoframe-members.html
/usr/share/doc/qt/qtmultimedia/qaudiobuffer-stereoframe.html
/usr/share/doc/qt/qtmultimedia/qaudiobuffer.html
/usr/share/doc/qt/qtmultimedia/qaudiodecoder-members.html
/usr/share/doc/qt/qtmultimedia/qaudiodecoder.html
/usr/share/doc/qt/qtmultimedia/qaudiodecodercontrol-members.html
/usr/share/doc/qt/qtmultimedia/qaudiodecodercontrol.html
/usr/share/doc/qt/qtmultimedia/qaudiodeviceinfo-members.html
/usr/share/doc/qt/qtmultimedia/qaudiodeviceinfo.html
/usr/share/doc/qt/qtmultimedia/qaudioencodersettings-members.html
/usr/share/doc/qt/qtmultimedia/qaudioencodersettings.html
/usr/share/doc/qt/qtmultimedia/qaudioencodersettingscontrol-members.html
/usr/share/doc/qt/qtmultimedia/qaudioencodersettingscontrol.html
/usr/share/doc/qt/qtmultimedia/qaudioformat-members.html
/usr/share/doc/qt/qtmultimedia/qaudioformat.html
/usr/share/doc/qt/qtmultimedia/qaudioinput-members.html
/usr/share/doc/qt/qtmultimedia/qaudioinput.html
/usr/share/doc/qt/qtmultimedia/qaudioinputselectorcontrol-members.html
/usr/share/doc/qt/qtmultimedia/qaudioinputselectorcontrol.html
/usr/share/doc/qt/qtmultimedia/qaudiooutput-members.html
/usr/share/doc/qt/qtmultimedia/qaudiooutput.html
/usr/share/doc/qt/qtmultimedia/qaudiooutputselectorcontrol-members.html
/usr/share/doc/qt/qtmultimedia/qaudiooutputselectorcontrol.html
/usr/share/doc/qt/qtmultimedia/qaudioprobe-members.html
/usr/share/doc/qt/qtmultimedia/qaudioprobe.html
/usr/share/doc/qt/qtmultimedia/qaudiorecorder-members.html
/usr/share/doc/qt/qtmultimedia/qaudiorecorder.html
/usr/share/doc/qt/qtmultimedia/qaudiorolecontrol-members.html
/usr/share/doc/qt/qtmultimedia/qaudiorolecontrol.html
/usr/share/doc/qt/qtmultimedia/qaudiosystemplugin-members.html
/usr/share/doc/qt/qtmultimedia/qaudiosystemplugin.html
/usr/share/doc/qt/qtmultimedia/qcamera-frameraterange-members.html
/usr/share/doc/qt/qtmultimedia/qcamera-frameraterange.html
/usr/share/doc/qt/qtmultimedia/qcamera-members.html
/usr/share/doc/qt/qtmultimedia/qcamera.html
/usr/share/doc/qt/qtmultimedia/qcameracapturebufferformatcontrol-members.html
/usr/share/doc/qt/qtmultimedia/qcameracapturebufferformatcontrol.html
/usr/share/doc/qt/qtmultimedia/qcameracapturedestinationcontrol-members.html
/usr/share/doc/qt/qtmultimedia/qcameracapturedestinationcontrol.html
/usr/share/doc/qt/qtmultimedia/qcameracontrol-members.html
/usr/share/doc/qt/qtmultimedia/qcameracontrol.html
/usr/share/doc/qt/qtmultimedia/qcameraexposure-members.html
/usr/share/doc/qt/qtmultimedia/qcameraexposure.html
/usr/share/doc/qt/qtmultimedia/qcameraexposurecontrol-members.html
/usr/share/doc/qt/qtmultimedia/qcameraexposurecontrol.html
/usr/share/doc/qt/qtmultimedia/qcamerafeedbackcontrol-members.html
/usr/share/doc/qt/qtmultimedia/qcamerafeedbackcontrol.html
/usr/share/doc/qt/qtmultimedia/qcameraflashcontrol-members.html
/usr/share/doc/qt/qtmultimedia/qcameraflashcontrol.html
/usr/share/doc/qt/qtmultimedia/qcamerafocus-members.html
/usr/share/doc/qt/qtmultimedia/qcamerafocus.html
/usr/share/doc/qt/qtmultimedia/qcamerafocuscontrol-members.html
/usr/share/doc/qt/qtmultimedia/qcamerafocuscontrol.html
/usr/share/doc/qt/qtmultimedia/qcamerafocuszone-members.html
/usr/share/doc/qt/qtmultimedia/qcamerafocuszone.html
/usr/share/doc/qt/qtmultimedia/qcameraimagecapture-members.html
/usr/share/doc/qt/qtmultimedia/qcameraimagecapture.html
/usr/share/doc/qt/qtmultimedia/qcameraimagecapturecontrol-members.html
/usr/share/doc/qt/qtmultimedia/qcameraimagecapturecontrol.html
/usr/share/doc/qt/qtmultimedia/qcameraimageprocessing-members.html
/usr/share/doc/qt/qtmultimedia/qcameraimageprocessing.html
/usr/share/doc/qt/qtmultimedia/qcameraimageprocessingcontrol-members.html
/usr/share/doc/qt/qtmultimedia/qcameraimageprocessingcontrol.html
/usr/share/doc/qt/qtmultimedia/qcamerainfo-members.html
/usr/share/doc/qt/qtmultimedia/qcamerainfo.html
/usr/share/doc/qt/qtmultimedia/qcamerainfocontrol-members.html
/usr/share/doc/qt/qtmultimedia/qcamerainfocontrol.html
/usr/share/doc/qt/qtmultimedia/qcameralockscontrol-members.html
/usr/share/doc/qt/qtmultimedia/qcameralockscontrol.html
/usr/share/doc/qt/qtmultimedia/qcameraviewfinder-members.html
/usr/share/doc/qt/qtmultimedia/qcameraviewfinder.html
/usr/share/doc/qt/qtmultimedia/qcameraviewfindersettings-members.html
/usr/share/doc/qt/qtmultimedia/qcameraviewfindersettings.html
/usr/share/doc/qt/qtmultimedia/qcameraviewfindersettingscontrol-members.html
/usr/share/doc/qt/qtmultimedia/qcameraviewfindersettingscontrol.html
/usr/share/doc/qt/qtmultimedia/qcameraviewfindersettingscontrol2-members.html
/usr/share/doc/qt/qtmultimedia/qcameraviewfindersettingscontrol2.html
/usr/share/doc/qt/qtmultimedia/qcamerazoomcontrol-members.html
/usr/share/doc/qt/qtmultimedia/qcamerazoomcontrol.html
/usr/share/doc/qt/qtmultimedia/qcustomaudiorolecontrol-members.html
/usr/share/doc/qt/qtmultimedia/qcustomaudiorolecontrol.html
/usr/share/doc/qt/qtmultimedia/qgraphicsvideoitem-members.html
/usr/share/doc/qt/qtmultimedia/qgraphicsvideoitem.html
/usr/share/doc/qt/qtmultimedia/qimageencodercontrol-members.html
/usr/share/doc/qt/qtmultimedia/qimageencodercontrol.html
/usr/share/doc/qt/qtmultimedia/qimageencodersettings-members.html
/usr/share/doc/qt/qtmultimedia/qimageencodersettings.html
/usr/share/doc/qt/qtmultimedia/qmediaaudioprobecontrol-members.html
/usr/share/doc/qt/qtmultimedia/qmediaaudioprobecontrol.html
/usr/share/doc/qt/qtmultimedia/qmediaavailabilitycontrol-members.html
/usr/share/doc/qt/qtmultimedia/qmediaavailabilitycontrol.html
/usr/share/doc/qt/qtmultimedia/qmediabindableinterface-members.html
/usr/share/doc/qt/qtmultimedia/qmediabindableinterface.html
/usr/share/doc/qt/qtmultimedia/qmediacontainercontrol-members.html
/usr/share/doc/qt/qtmultimedia/qmediacontainercontrol.html
/usr/share/doc/qt/qtmultimedia/qmediacontent-members.html
/usr/share/doc/qt/qtmultimedia/qmediacontent-obsolete.html
/usr/share/doc/qt/qtmultimedia/qmediacontent.html
/usr/share/doc/qt/qtmultimedia/qmediacontrol-members.html
/usr/share/doc/qt/qtmultimedia/qmediacontrol.html
/usr/share/doc/qt/qtmultimedia/qmediagaplessplaybackcontrol-members.html
/usr/share/doc/qt/qtmultimedia/qmediagaplessplaybackcontrol.html
/usr/share/doc/qt/qtmultimedia/qmediametadata.html
/usr/share/doc/qt/qtmultimedia/qmedianetworkaccesscontrol-members.html
/usr/share/doc/qt/qtmultimedia/qmedianetworkaccesscontrol.html
/usr/share/doc/qt/qtmultimedia/qmediaobject-members.html
/usr/share/doc/qt/qtmultimedia/qmediaobject.html
/usr/share/doc/qt/qtmultimedia/qmediaplayer-members.html
/usr/share/doc/qt/qtmultimedia/qmediaplayer-obsolete.html
/usr/share/doc/qt/qtmultimedia/qmediaplayer.html
/usr/share/doc/qt/qtmultimedia/qmediaplayercontrol-members.html
/usr/share/doc/qt/qtmultimedia/qmediaplayercontrol.html
/usr/share/doc/qt/qtmultimedia/qmediaplaylist-members.html
/usr/share/doc/qt/qtmultimedia/qmediaplaylist.html
/usr/share/doc/qt/qtmultimedia/qmediarecorder-members.html
/usr/share/doc/qt/qtmultimedia/qmediarecorder.html
/usr/share/doc/qt/qtmultimedia/qmediarecordercontrol-members.html
/usr/share/doc/qt/qtmultimedia/qmediarecordercontrol.html
/usr/share/doc/qt/qtmultimedia/qmediaresource-members.html
/usr/share/doc/qt/qtmultimedia/qmediaresource.html
/usr/share/doc/qt/qtmultimedia/qmediaservice-members.html
/usr/share/doc/qt/qtmultimedia/qmediaservice.html
/usr/share/doc/qt/qtmultimedia/qmediaservicecamerainfointerface-members.html
/usr/share/doc/qt/qtmultimedia/qmediaservicecamerainfointerface.html
/usr/share/doc/qt/qtmultimedia/qmediaservicedefaultdeviceinterface-members.html
/usr/share/doc/qt/qtmultimedia/qmediaservicedefaultdeviceinterface.html
/usr/share/doc/qt/qtmultimedia/qmediaservicefeaturesinterface-members.html
/usr/share/doc/qt/qtmultimedia/qmediaservicefeaturesinterface.html
/usr/share/doc/qt/qtmultimedia/qmediaserviceproviderplugin-members.html
/usr/share/doc/qt/qtmultimedia/qmediaserviceproviderplugin.html
/usr/share/doc/qt/qtmultimedia/qmediaservicesupporteddevicesinterface-members.html
/usr/share/doc/qt/qtmultimedia/qmediaservicesupporteddevicesinterface.html
/usr/share/doc/qt/qtmultimedia/qmediaservicesupportedformatsinterface-members.html
/usr/share/doc/qt/qtmultimedia/qmediaservicesupportedformatsinterface.html
/usr/share/doc/qt/qtmultimedia/qmediastreamscontrol-members.html
/usr/share/doc/qt/qtmultimedia/qmediastreamscontrol.html
/usr/share/doc/qt/qtmultimedia/qmediatimeinterval-members.html
/usr/share/doc/qt/qtmultimedia/qmediatimeinterval.html
/usr/share/doc/qt/qtmultimedia/qmediatimerange-members.html
/usr/share/doc/qt/qtmultimedia/qmediatimerange.html
/usr/share/doc/qt/qtmultimedia/qmediavideoprobecontrol-members.html
/usr/share/doc/qt/qtmultimedia/qmediavideoprobecontrol.html
/usr/share/doc/qt/qtmultimedia/qmetadatareadercontrol-members.html
/usr/share/doc/qt/qtmultimedia/qmetadatareadercontrol.html
/usr/share/doc/qt/qtmultimedia/qmetadatawritercontrol-members.html
/usr/share/doc/qt/qtmultimedia/qmetadatawritercontrol.html
/usr/share/doc/qt/qtmultimedia/qml-multimedia.html
/usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-attenuationmodelinverse-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-attenuationmodelinverse.html
/usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-attenuationmodellinear-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-attenuationmodellinear.html
/usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-audiocategory-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-audiocategory.html
/usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-audioengine-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-audioengine.html
/usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-audiolistener-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-audiolistener.html
/usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-audiosample-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-audiosample.html
/usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-playvariation-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-playvariation.html
/usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-sound-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-sound.html
/usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-soundinstance-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtaudioengine-soundinstance.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-audio-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-audio.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-camera-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-camera.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-cameracapture-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-cameracapture.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-cameraexposure-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-cameraexposure.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-cameraflash-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-cameraflash.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-camerafocus-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-camerafocus.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-cameraimageprocessing-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-cameraimageprocessing.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-camerarecorder-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-camerarecorder.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-mediaplayer-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-mediaplayer.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-playlist-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-playlist.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-playlistitem-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-playlistitem.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-qtmultimedia-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-qtmultimedia.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-radio-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-radio.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-radiodata-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-radiodata.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-soundeffect-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-soundeffect.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-torch-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-torch.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-video-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-video.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-videooutput-members.html
/usr/share/doc/qt/qtmultimedia/qml-qtmultimedia-videooutput.html
/usr/share/doc/qt/qtmultimedia/qmultimedia.html
/usr/share/doc/qt/qtmultimedia/qradiodata-members.html
/usr/share/doc/qt/qtmultimedia/qradiodata.html
/usr/share/doc/qt/qtmultimedia/qradiodatacontrol-members.html
/usr/share/doc/qt/qtmultimedia/qradiodatacontrol.html
/usr/share/doc/qt/qtmultimedia/qradiotuner-members.html
/usr/share/doc/qt/qtmultimedia/qradiotuner.html
/usr/share/doc/qt/qtmultimedia/qradiotunercontrol-members.html
/usr/share/doc/qt/qtmultimedia/qradiotunercontrol.html
/usr/share/doc/qt/qtmultimedia/qsound-members.html
/usr/share/doc/qt/qtmultimedia/qsound.html
/usr/share/doc/qt/qtmultimedia/qsoundeffect-members.html
/usr/share/doc/qt/qtmultimedia/qsoundeffect.html
/usr/share/doc/qt/qtmultimedia/qtaudioengine-qmlmodule.html
/usr/share/doc/qt/qtmultimedia/qtmultimedia-index.html
/usr/share/doc/qt/qtmultimedia/qtmultimedia-ios.html
/usr/share/doc/qt/qtmultimedia/qtmultimedia-module.html
/usr/share/doc/qt/qtmultimedia/qtmultimedia-modules.html
/usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audiodevices-example.html
/usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audioengine-example.html
/usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audioinput-example.html
/usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audiooutput-example.html
/usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-audiorecorder-example.html
/usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-camera-example.html
/usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-declarative-radio-example.html
/usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-spectrum-example.html
/usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideo-example.html
/usr/share/doc/qt/qtmultimedia/qtmultimedia-multimedia-video-qmlvideofx-example.html
/usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-camera-example.html
/usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-player-example.html
/usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-videographicsitem-example.html
/usr/share/doc/qt/qtmultimedia/qtmultimedia-multimediawidgets-videowidget-example.html
/usr/share/doc/qt/qtmultimedia/qtmultimedia-qmlmodule.html
/usr/share/doc/qt/qtmultimedia/qtmultimedia-windows.html
/usr/share/doc/qt/qtmultimedia/qtmultimedia.index
/usr/share/doc/qt/qtmultimedia/qtmultimedia.qhp
/usr/share/doc/qt/qtmultimedia/qtmultimedia.qhp.sha1
/usr/share/doc/qt/qtmultimedia/qtmultimediawidgets-index.html
/usr/share/doc/qt/qtmultimedia/qtmultimediawidgets-module.html
/usr/share/doc/qt/qtmultimedia/qvideodeviceselectorcontrol-members.html
/usr/share/doc/qt/qtmultimedia/qvideodeviceselectorcontrol.html
/usr/share/doc/qt/qtmultimedia/qvideoencodersettings-members.html
/usr/share/doc/qt/qtmultimedia/qvideoencodersettings.html
/usr/share/doc/qt/qtmultimedia/qvideoencodersettingscontrol-members.html
/usr/share/doc/qt/qtmultimedia/qvideoencodersettingscontrol.html
/usr/share/doc/qt/qtmultimedia/qvideofilterrunnable-members.html
/usr/share/doc/qt/qtmultimedia/qvideofilterrunnable.html
/usr/share/doc/qt/qtmultimedia/qvideoframe-members.html
/usr/share/doc/qt/qtmultimedia/qvideoframe.html
/usr/share/doc/qt/qtmultimedia/qvideoprobe-members.html
/usr/share/doc/qt/qtmultimedia/qvideoprobe.html
/usr/share/doc/qt/qtmultimedia/qvideorenderercontrol-members.html
/usr/share/doc/qt/qtmultimedia/qvideorenderercontrol.html
/usr/share/doc/qt/qtmultimedia/qvideosurfaceformat-members.html
/usr/share/doc/qt/qtmultimedia/qvideosurfaceformat.html
/usr/share/doc/qt/qtmultimedia/qvideowidget-members.html
/usr/share/doc/qt/qtmultimedia/qvideowidget.html
/usr/share/doc/qt/qtmultimedia/qvideowidgetcontrol-members.html
/usr/share/doc/qt/qtmultimedia/qvideowidgetcontrol.html
/usr/share/doc/qt/qtmultimedia/qvideowindowcontrol-members.html
/usr/share/doc/qt/qtmultimedia/qvideowindowcontrol.html
/usr/share/doc/qt/qtmultimedia/radiooverview.html
/usr/share/doc/qt/qtmultimedia/videooverview.html
/usr/share/doc/qt/qtmultimedia/images/arrow_bc.png
/usr/share/doc/qt/qtmultimedia/images/audiodevices.png
/usr/share/doc/qt/qtmultimedia/images/audioinput-example.png
/usr/share/doc/qt/qtmultimedia/images/audiooutput-example.png
/usr/share/doc/qt/qtmultimedia/images/audiorecorder.png
/usr/share/doc/qt/qtmultimedia/images/bgrContent.png
/usr/share/doc/qt/qtmultimedia/images/btn_next.png
/usr/share/doc/qt/qtmultimedia/images/btn_prev.png
/usr/share/doc/qt/qtmultimedia/images/bullet_dn.png
/usr/share/doc/qt/qtmultimedia/images/bullet_sq.png
/usr/share/doc/qt/qtmultimedia/images/camera-example.png
/usr/share/doc/qt/qtmultimedia/images/declarative-radio-example.png
/usr/share/doc/qt/qtmultimedia/images/home.png
/usr/share/doc/qt/qtmultimedia/images/ico_note.png
/usr/share/doc/qt/qtmultimedia/images/ico_note_attention.png
/usr/share/doc/qt/qtmultimedia/images/ico_out.png
/usr/share/doc/qt/qtmultimedia/images/logo.png
/usr/share/doc/qt/qtmultimedia/images/mediaplayerex.jpg
/usr/share/doc/qt/qtmultimedia/images/qml-camera.png
/usr/share/doc/qt/qtmultimedia/images/qmlvideo-menu.jpg
/usr/share/doc/qt/qtmultimedia/images/qmlvideo-overlay.jpg
/usr/share/doc/qt/qtmultimedia/images/qmlvideofx-camera-glow.jpg
/usr/share/doc/qt/qtmultimedia/images/qmlvideofx-camera-wobble.jpg
/usr/share/doc/qt/qtmultimedia/images/qmlvideofx-effects-menu.jpg
/usr/share/doc/qt/qtmultimedia/images/qmlvideofx-video-edgedetection.jpg
/usr/share/doc/qt/qtmultimedia/images/qmlvideofx-video-pagecurl.jpg
/usr/share/doc/qt/qtmultimedia/images/radio-example.png
/usr/share/doc/qt/qtmultimedia/images/spectrum-demo.png
/usr/share/doc/qt/qtmultimedia/images/video-qml-paint-rate.png
/usr/share/doc/qt/qtmultimedia/images/video-videographicsitem.png
/usr/share/doc/qt/qtmultimedia/images/video-videowidget.png
/usr/share/doc/qt/qtmultimedia/style/offline-simple.css
/usr/share/doc/qt/qtmultimedia/style/offline.css
/usr/share/doc/qt/qtnetwork/bearer-management.html
/usr/share/doc/qt/qtnetwork/examples-manifest.xml
/usr/share/doc/qt/qtnetwork/examples-network.html
/usr/share/doc/qt/qtnetwork/network.html
/usr/share/doc/qt/qtnetwork/qabstractnetworkcache-members.html
/usr/share/doc/qt/qtnetwork/qabstractnetworkcache.html
/usr/share/doc/qt/qtnetwork/qabstractsocket-members.html
/usr/share/doc/qt/qtnetwork/qabstractsocket.html
/usr/share/doc/qt/qtnetwork/qauthenticator-members.html
/usr/share/doc/qt/qtnetwork/qauthenticator.html
/usr/share/doc/qt/qtnetwork/qdnsdomainnamerecord-members.html
/usr/share/doc/qt/qtnetwork/qdnsdomainnamerecord.html
/usr/share/doc/qt/qtnetwork/qdnshostaddressrecord-members.html
/usr/share/doc/qt/qtnetwork/qdnshostaddressrecord.html
/usr/share/doc/qt/qtnetwork/qdnslookup-members.html
/usr/share/doc/qt/qtnetwork/qdnslookup.html
/usr/share/doc/qt/qtnetwork/qdnsmailexchangerecord-members.html
/usr/share/doc/qt/qtnetwork/qdnsmailexchangerecord.html
/usr/share/doc/qt/qtnetwork/qdnsservicerecord-members.html
/usr/share/doc/qt/qtnetwork/qdnsservicerecord.html
/usr/share/doc/qt/qtnetwork/qdnstextrecord-members.html
/usr/share/doc/qt/qtnetwork/qdnstextrecord.html
/usr/share/doc/qt/qtnetwork/qdtls-members.html
/usr/share/doc/qt/qtnetwork/qdtls.html
/usr/share/doc/qt/qtnetwork/qdtlsclientverifier-generatorparameters-members.html
/usr/share/doc/qt/qtnetwork/qdtlsclientverifier-generatorparameters.html
/usr/share/doc/qt/qtnetwork/qdtlsclientverifier-members.html
/usr/share/doc/qt/qtnetwork/qdtlsclientverifier.html
/usr/share/doc/qt/qtnetwork/qhash-proxy.html
/usr/share/doc/qt/qtnetwork/qhostaddress-members.html
/usr/share/doc/qt/qtnetwork/qhostaddress.html
/usr/share/doc/qt/qtnetwork/qhostinfo-members.html
/usr/share/doc/qt/qtnetwork/qhostinfo.html
/usr/share/doc/qt/qtnetwork/qhstspolicy-members.html
/usr/share/doc/qt/qtnetwork/qhstspolicy.html
/usr/share/doc/qt/qtnetwork/qhttpmultipart-members.html
/usr/share/doc/qt/qtnetwork/qhttpmultipart.html
/usr/share/doc/qt/qtnetwork/qhttppart-members.html
/usr/share/doc/qt/qtnetwork/qhttppart.html
/usr/share/doc/qt/qtnetwork/qlocalserver-members.html
/usr/share/doc/qt/qtnetwork/qlocalserver.html
/usr/share/doc/qt/qtnetwork/qlocalsocket-members.html
/usr/share/doc/qt/qtnetwork/qlocalsocket.html
/usr/share/doc/qt/qtnetwork/qnetworkaccessmanager-members.html
/usr/share/doc/qt/qtnetwork/qnetworkaccessmanager.html
/usr/share/doc/qt/qtnetwork/qnetworkaddressentry-members.html
/usr/share/doc/qt/qtnetwork/qnetworkaddressentry.html
/usr/share/doc/qt/qtnetwork/qnetworkcachemetadata-members.html
/usr/share/doc/qt/qtnetwork/qnetworkcachemetadata.html
/usr/share/doc/qt/qtnetwork/qnetworkconfiguration-members.html
/usr/share/doc/qt/qtnetwork/qnetworkconfiguration.html
/usr/share/doc/qt/qtnetwork/qnetworkconfigurationmanager-members.html
/usr/share/doc/qt/qtnetwork/qnetworkconfigurationmanager.html
/usr/share/doc/qt/qtnetwork/qnetworkcookie-members.html
/usr/share/doc/qt/qtnetwork/qnetworkcookie.html
/usr/share/doc/qt/qtnetwork/qnetworkcookiejar-members.html
/usr/share/doc/qt/qtnetwork/qnetworkcookiejar.html
/usr/share/doc/qt/qtnetwork/qnetworkdatagram-members.html
/usr/share/doc/qt/qtnetwork/qnetworkdatagram.html
/usr/share/doc/qt/qtnetwork/qnetworkdiskcache-members.html
/usr/share/doc/qt/qtnetwork/qnetworkdiskcache.html
/usr/share/doc/qt/qtnetwork/qnetworkinterface-members.html
/usr/share/doc/qt/qtnetwork/qnetworkinterface.html
/usr/share/doc/qt/qtnetwork/qnetworkproxy-members.html
/usr/share/doc/qt/qtnetwork/qnetworkproxy.html
/usr/share/doc/qt/qtnetwork/qnetworkproxyfactory-members.html
/usr/share/doc/qt/qtnetwork/qnetworkproxyfactory.html
/usr/share/doc/qt/qtnetwork/qnetworkproxyquery-members.html
/usr/share/doc/qt/qtnetwork/qnetworkproxyquery-obsolete.html
/usr/share/doc/qt/qtnetwork/qnetworkproxyquery.html
/usr/share/doc/qt/qtnetwork/qnetworkreply-members.html
/usr/share/doc/qt/qtnetwork/qnetworkreply.html
/usr/share/doc/qt/qtnetwork/qnetworkrequest-members.html
/usr/share/doc/qt/qtnetwork/qnetworkrequest.html
/usr/share/doc/qt/qtnetwork/qnetworksession-members.html
/usr/share/doc/qt/qtnetwork/qnetworksession.html
/usr/share/doc/qt/qtnetwork/qocspresponse-members.html
/usr/share/doc/qt/qtnetwork/qocspresponse.html
/usr/share/doc/qt/qtnetwork/qpassworddigestor.html
/usr/share/doc/qt/qtnetwork/qsctpserver-members.html
/usr/share/doc/qt/qtnetwork/qsctpserver.html
/usr/share/doc/qt/qtnetwork/qsctpsocket-members.html
/usr/share/doc/qt/qtnetwork/qsctpsocket.html
/usr/share/doc/qt/qtnetwork/qssl-obsolete.html
/usr/share/doc/qt/qtnetwork/qssl.html
/usr/share/doc/qt/qtnetwork/qsslcertificate-members.html
/usr/share/doc/qt/qtnetwork/qsslcertificate-obsolete.html
/usr/share/doc/qt/qtnetwork/qsslcertificate.html
/usr/share/doc/qt/qtnetwork/qsslcertificateextension-members.html
/usr/share/doc/qt/qtnetwork/qsslcertificateextension.html
/usr/share/doc/qt/qtnetwork/qsslcipher-members.html
/usr/share/doc/qt/qtnetwork/qsslcipher.html
/usr/share/doc/qt/qtnetwork/qsslconfiguration-members.html
/usr/share/doc/qt/qtnetwork/qsslconfiguration.html
/usr/share/doc/qt/qtnetwork/qssldiffiehellmanparameters-members.html
/usr/share/doc/qt/qtnetwork/qssldiffiehellmanparameters.html
/usr/share/doc/qt/qtnetwork/qsslellipticcurve-members.html
/usr/share/doc/qt/qtnetwork/qsslellipticcurve.html
/usr/share/doc/qt/qtnetwork/qsslerror-members.html
/usr/share/doc/qt/qtnetwork/qsslerror.html
/usr/share/doc/qt/qtnetwork/qsslkey-members.html
/usr/share/doc/qt/qtnetwork/qsslkey.html
/usr/share/doc/qt/qtnetwork/qsslpresharedkeyauthenticator-members.html
/usr/share/doc/qt/qtnetwork/qsslpresharedkeyauthenticator.html
/usr/share/doc/qt/qtnetwork/qsslsocket-members.html
/usr/share/doc/qt/qtnetwork/qsslsocket-obsolete.html
/usr/share/doc/qt/qtnetwork/qsslsocket.html
/usr/share/doc/qt/qtnetwork/qtcpserver-members.html
/usr/share/doc/qt/qtnetwork/qtcpserver.html
/usr/share/doc/qt/qtnetwork/qtcpsocket-members.html
/usr/share/doc/qt/qtnetwork/qtcpsocket.html
/usr/share/doc/qt/qtnetwork/qtnetwork-blockingfortuneclient-example.html
/usr/share/doc/qt/qtnetwork/qtnetwork-broadcastreceiver-example.html
/usr/share/doc/qt/qtnetwork/qtnetwork-broadcastsender-example.html
/usr/share/doc/qt/qtnetwork/qtnetwork-download-example.html
/usr/share/doc/qt/qtnetwork/qtnetwork-downloadmanager-example.html
/usr/share/doc/qt/qtnetwork/qtnetwork-fortuneclient-example.html
/usr/share/doc/qt/qtnetwork/qtnetwork-fortuneserver-example.html
/usr/share/doc/qt/qtnetwork/qtnetwork-googlesuggest-example.html
/usr/share/doc/qt/qtnetwork/qtnetwork-http-example.html
/usr/share/doc/qt/qtnetwork/qtnetwork-index.html
/usr/share/doc/qt/qtnetwork/qtnetwork-loopback-example.html
/usr/share/doc/qt/qtnetwork/qtnetwork-module.html
/usr/share/doc/qt/qtnetwork/qtnetwork-multicastreceiver-example.html
/usr/share/doc/qt/qtnetwork/qtnetwork-multicastsender-example.html
/usr/share/doc/qt/qtnetwork/qtnetwork-network-chat-example.html
/usr/share/doc/qt/qtnetwork/qtnetwork-programming.html
/usr/share/doc/qt/qtnetwork/qtnetwork-securesocketclient-example.html
/usr/share/doc/qt/qtnetwork/qtnetwork-secureudpclient-example.html
/usr/share/doc/qt/qtnetwork/qtnetwork-secureudpserver-example.html
/usr/share/doc/qt/qtnetwork/qtnetwork-threadedfortuneserver-example.html
/usr/share/doc/qt/qtnetwork/qtnetwork-torrent-example.html
/usr/share/doc/qt/qtnetwork/qtnetwork.index
/usr/share/doc/qt/qtnetwork/qtnetwork.qhp
/usr/share/doc/qt/qtnetwork/qtnetwork.qhp.sha1
/usr/share/doc/qt/qtnetwork/qtnetwork.tags
/usr/share/doc/qt/qtnetwork/qudpsocket-members.html
/usr/share/doc/qt/qtnetwork/qudpsocket.html
/usr/share/doc/qt/qtnetwork/ssl.html
/usr/share/doc/qt/qtnetwork/images/arrow_bc.png
/usr/share/doc/qt/qtnetwork/images/bgrContent.png
/usr/share/doc/qt/qtnetwork/images/blockingfortuneclient-example.png
/usr/share/doc/qt/qtnetwork/images/broadcastreceiver-example.png
/usr/share/doc/qt/qtnetwork/images/broadcastsender-example.png
/usr/share/doc/qt/qtnetwork/images/btn_next.png
/usr/share/doc/qt/qtnetwork/images/btn_prev.png
/usr/share/doc/qt/qtnetwork/images/bullet_dn.png
/usr/share/doc/qt/qtnetwork/images/bullet_sq.png
/usr/share/doc/qt/qtnetwork/images/fortuneclient-example.png
/usr/share/doc/qt/qtnetwork/images/fortuneserver-example.png
/usr/share/doc/qt/qtnetwork/images/googlesuggest-example.png
/usr/share/doc/qt/qtnetwork/images/home.png
/usr/share/doc/qt/qtnetwork/images/http-example.png
/usr/share/doc/qt/qtnetwork/images/ico_note.png
/usr/share/doc/qt/qtnetwork/images/ico_note_attention.png
/usr/share/doc/qt/qtnetwork/images/ico_out.png
/usr/share/doc/qt/qtnetwork/images/logo.png
/usr/share/doc/qt/qtnetwork/images/loopback-example.png
/usr/share/doc/qt/qtnetwork/images/multicastreceiver-example.png
/usr/share/doc/qt/qtnetwork/images/multicastsender-example.png
/usr/share/doc/qt/qtnetwork/images/network-chat-example.png
/usr/share/doc/qt/qtnetwork/images/network-examples.png
/usr/share/doc/qt/qtnetwork/images/roaming-states.png
/usr/share/doc/qt/qtnetwork/images/securesocketclient.png
/usr/share/doc/qt/qtnetwork/images/securesocketclient2.png
/usr/share/doc/qt/qtnetwork/images/secureudpclient-example.png
/usr/share/doc/qt/qtnetwork/images/secureudpserver-example.png
/usr/share/doc/qt/qtnetwork/images/tcpstream.png
/usr/share/doc/qt/qtnetwork/images/threadedfortuneserver-example.png
/usr/share/doc/qt/qtnetwork/images/torrent-example.png
/usr/share/doc/qt/qtnetwork/images/udppackets.png
/usr/share/doc/qt/qtnetwork/style/offline-simple.css
/usr/share/doc/qt/qtnetwork/style/offline.css
/usr/share/doc/qt/qtnetworkauth/examples-manifest.xml
/usr/share/doc/qt/qtnetworkauth/examples-qtnetworkauth.html
/usr/share/doc/qt/qtnetworkauth/qabstractoauth-members.html
/usr/share/doc/qt/qtnetworkauth/qabstractoauth.html
/usr/share/doc/qt/qtnetworkauth/qabstractoauth2-members.html
/usr/share/doc/qt/qtnetworkauth/qabstractoauth2.html
/usr/share/doc/qt/qtnetworkauth/qabstractoauthreplyhandler-members.html
/usr/share/doc/qt/qtnetworkauth/qabstractoauthreplyhandler.html
/usr/share/doc/qt/qtnetworkauth/qoauth1-members.html
/usr/share/doc/qt/qtnetworkauth/qoauth1.html
/usr/share/doc/qt/qtnetworkauth/qoauth1signature-members.html
/usr/share/doc/qt/qtnetworkauth/qoauth1signature.html
/usr/share/doc/qt/qtnetworkauth/qoauth2authorizationcodeflow-members.html
/usr/share/doc/qt/qtnetworkauth/qoauth2authorizationcodeflow.html
/usr/share/doc/qt/qtnetworkauth/qtnetworkauth-index.html
/usr/share/doc/qt/qtnetworkauth/qtnetworkauth-module.html
/usr/share/doc/qt/qtnetworkauth/qtnetworkauth-redditclient-example.html
/usr/share/doc/qt/qtnetworkauth/qtnetworkauth-twittertimeline-example.html
/usr/share/doc/qt/qtnetworkauth/qtnetworkauth.index
/usr/share/doc/qt/qtnetworkauth/qtnetworkauth.qhp
/usr/share/doc/qt/qtnetworkauth/qtnetworkauth.qhp.sha1
/usr/share/doc/qt/qtnetworkauth/qtnetworkauth.tags
/usr/share/doc/qt/qtnetworkauth/images/arrow_bc.png
/usr/share/doc/qt/qtnetworkauth/images/bgrContent.png
/usr/share/doc/qt/qtnetworkauth/images/btn_next.png
/usr/share/doc/qt/qtnetworkauth/images/btn_prev.png
/usr/share/doc/qt/qtnetworkauth/images/bullet_dn.png
/usr/share/doc/qt/qtnetworkauth/images/bullet_sq.png
/usr/share/doc/qt/qtnetworkauth/images/home.png
/usr/share/doc/qt/qtnetworkauth/images/ico_note.png
/usr/share/doc/qt/qtnetworkauth/images/ico_note_attention.png
/usr/share/doc/qt/qtnetworkauth/images/ico_out.png
/usr/share/doc/qt/qtnetworkauth/images/logo.png
/usr/share/doc/qt/qtnetworkauth/images/redditclient-example.png
/usr/share/doc/qt/qtnetworkauth/images/twittertimeline-example.png
/usr/share/doc/qt/qtnetworkauth/style/offline-simple.css
/usr/share/doc/qt/qtnetworkauth/style/offline.css
/usr/share/doc/qt/qtnfc/examples-manifest.xml
/usr/share/doc/qt/qtnfc/nfc-android.html
/usr/share/doc/qt/qtnfc/nfc-examples.html
/usr/share/doc/qt/qtnfc/qml-qtnfc-ndeffilter-members.html
/usr/share/doc/qt/qtnfc/qml-qtnfc-ndeffilter.html
/usr/share/doc/qt/qtnfc/qml-qtnfc-ndefmimerecord-members.html
/usr/share/doc/qt/qtnfc/qml-qtnfc-ndefmimerecord.html
/usr/share/doc/qt/qtnfc/qml-qtnfc-ndefrecord-members.html
/usr/share/doc/qt/qtnfc/qml-qtnfc-ndefrecord.html
/usr/share/doc/qt/qtnfc/qml-qtnfc-ndeftextrecord-members.html
/usr/share/doc/qt/qtnfc/qml-qtnfc-ndeftextrecord.html
/usr/share/doc/qt/qtnfc/qml-qtnfc-ndefurirecord-members.html
/usr/share/doc/qt/qtnfc/qml-qtnfc-ndefurirecord.html
/usr/share/doc/qt/qtnfc/qml-qtnfc-nearfield-members.html
/usr/share/doc/qt/qtnfc/qml-qtnfc-nearfield.html
/usr/share/doc/qt/qtnfc/qndeffilter-members.html
/usr/share/doc/qt/qtnfc/qndeffilter.html
/usr/share/doc/qt/qtnfc/qndefmessage-members.html
/usr/share/doc/qt/qtnfc/qndefmessage.html
/usr/share/doc/qt/qtnfc/qndefnfcsmartposterrecord-members.html
/usr/share/doc/qt/qtnfc/qndefnfcsmartposterrecord.html
/usr/share/doc/qt/qtnfc/qndefnfctextrecord-members.html
/usr/share/doc/qt/qtnfc/qndefnfctextrecord.html
/usr/share/doc/qt/qtnfc/qndefnfcurirecord-members.html
/usr/share/doc/qt/qtnfc/qndefnfcurirecord.html
/usr/share/doc/qt/qtnfc/qndefrecord-members.html
/usr/share/doc/qt/qtnfc/qndefrecord.html
/usr/share/doc/qt/qtnfc/qnearfieldmanager-members.html
/usr/share/doc/qt/qtnfc/qnearfieldmanager.html
/usr/share/doc/qt/qtnfc/qnearfieldsharemanager-members.html
/usr/share/doc/qt/qtnfc/qnearfieldsharemanager.html
/usr/share/doc/qt/qtnfc/qnearfieldsharetarget-members.html
/usr/share/doc/qt/qtnfc/qnearfieldsharetarget.html
/usr/share/doc/qt/qtnfc/qnearfieldtarget-members.html
/usr/share/doc/qt/qtnfc/qnearfieldtarget.html
/usr/share/doc/qt/qtnfc/qqmlndefrecord-members.html
/usr/share/doc/qt/qtnfc/qqmlndefrecord.html
/usr/share/doc/qt/qtnfc/qtnfc-annotatedurl-example.html
/usr/share/doc/qt/qtnfc/qtnfc-corkboard-example.html
/usr/share/doc/qt/qtnfc/qtnfc-index.html
/usr/share/doc/qt/qtnfc/qtnfc-module.html
/usr/share/doc/qt/qtnfc/qtnfc-ndefeditor-example.html
/usr/share/doc/qt/qtnfc/qtnfc-overview.html
/usr/share/doc/qt/qtnfc/qtnfc-poster-example.html
/usr/share/doc/qt/qtnfc/qtnfc-qmlmodule.html
/usr/share/doc/qt/qtnfc/qtnfc.index
/usr/share/doc/qt/qtnfc/qtnfc.qhp
/usr/share/doc/qt/qtnfc/qtnfc.qhp.sha1
/usr/share/doc/qt/qtnfc/qtnfc.tags
/usr/share/doc/qt/qtnfc/images/annotatedurl.png
/usr/share/doc/qt/qtnfc/images/annotatedurl2.png
/usr/share/doc/qt/qtnfc/images/arrow_bc.png
/usr/share/doc/qt/qtnfc/images/bgrContent.png
/usr/share/doc/qt/qtnfc/images/btn_next.png
/usr/share/doc/qt/qtnfc/images/btn_prev.png
/usr/share/doc/qt/qtnfc/images/bullet_dn.png
/usr/share/doc/qt/qtnfc/images/bullet_sq.png
/usr/share/doc/qt/qtnfc/images/corkboard.png
/usr/share/doc/qt/qtnfc/images/home.png
/usr/share/doc/qt/qtnfc/images/ico_note.png
/usr/share/doc/qt/qtnfc/images/ico_note_attention.png
/usr/share/doc/qt/qtnfc/images/ico_out.png
/usr/share/doc/qt/qtnfc/images/logo.png
/usr/share/doc/qt/qtnfc/images/ndefeditor.png
/usr/share/doc/qt/qtnfc/images/qml-poster-example.png
/usr/share/doc/qt/qtnfc/style/offline-simple.css
/usr/share/doc/qt/qtnfc/style/offline.css
/usr/share/doc/qt/qtopengl/examples-manifest.xml
/usr/share/doc/qt/qtopengl/examples-widgets-opengl.html
/usr/share/doc/qt/qtopengl/qgl.html
/usr/share/doc/qt/qtopengl/qglbuffer-members.html
/usr/share/doc/qt/qtopengl/qglbuffer.html
/usr/share/doc/qt/qtopengl/qglcolormap-members.html
/usr/share/doc/qt/qtopengl/qglcolormap.html
/usr/share/doc/qt/qtopengl/qglcontext-members.html
/usr/share/doc/qt/qtopengl/qglcontext-obsolete.html
/usr/share/doc/qt/qtopengl/qglcontext.html
/usr/share/doc/qt/qtopengl/qglformat-members.html
/usr/share/doc/qt/qtopengl/qglformat.html
/usr/share/doc/qt/qtopengl/qglframebufferobject-members.html
/usr/share/doc/qt/qtopengl/qglframebufferobject.html
/usr/share/doc/qt/qtopengl/qglframebufferobjectformat-members.html
/usr/share/doc/qt/qtopengl/qglframebufferobjectformat.html
/usr/share/doc/qt/qtopengl/qglfunctions-members.html
/usr/share/doc/qt/qtopengl/qglfunctions.html
/usr/share/doc/qt/qtopengl/qglpixelbuffer-members.html
/usr/share/doc/qt/qtopengl/qglpixelbuffer.html
/usr/share/doc/qt/qtopengl/qglshader-members.html
/usr/share/doc/qt/qtopengl/qglshader.html
/usr/share/doc/qt/qtopengl/qglshaderprogram-members.html
/usr/share/doc/qt/qtopengl/qglshaderprogram.html
/usr/share/doc/qt/qtopengl/qglwidget-members.html
/usr/share/doc/qt/qtopengl/qglwidget-obsolete.html
/usr/share/doc/qt/qtopengl/qglwidget.html
/usr/share/doc/qt/qtopengl/qtopengl-2dpainting-example.html
/usr/share/doc/qt/qtopengl/qtopengl-cube-example.html
/usr/share/doc/qt/qtopengl/qtopengl-hellogl2-example.html
/usr/share/doc/qt/qtopengl/qtopengl-hellogles3-example.html
/usr/share/doc/qt/qtopengl/qtopengl-index.html
/usr/share/doc/qt/qtopengl/qtopengl-module.html
/usr/share/doc/qt/qtopengl/qtopengl-textures-example.html
/usr/share/doc/qt/qtopengl/qtopengl.index
/usr/share/doc/qt/qtopengl/qtopengl.qhp
/usr/share/doc/qt/qtopengl/qtopengl.qhp.sha1
/usr/share/doc/qt/qtopengl/qtopengl.tags
/usr/share/doc/qt/qtopengl/images/2dpainting-example.png
/usr/share/doc/qt/qtopengl/images/arrow_bc.png
/usr/share/doc/qt/qtopengl/images/bgrContent.png
/usr/share/doc/qt/qtopengl/images/btn_next.png
/usr/share/doc/qt/qtopengl/images/btn_prev.png
/usr/share/doc/qt/qtopengl/images/bullet_dn.png
/usr/share/doc/qt/qtopengl/images/bullet_sq.png
/usr/share/doc/qt/qtopengl/images/cube.png
/usr/share/doc/qt/qtopengl/images/cube_faces.png
/usr/share/doc/qt/qtopengl/images/hellogl2-example.png
/usr/share/doc/qt/qtopengl/images/hellogles3-example.png
/usr/share/doc/qt/qtopengl/images/home.png
/usr/share/doc/qt/qtopengl/images/ico_note.png
/usr/share/doc/qt/qtopengl/images/ico_note_attention.png
/usr/share/doc/qt/qtopengl/images/ico_out.png
/usr/share/doc/qt/qtopengl/images/logo.png
/usr/share/doc/qt/qtopengl/images/opengl-examples.png
/usr/share/doc/qt/qtopengl/images/textures-example.png
/usr/share/doc/qt/qtopengl/style/offline-simple.css
/usr/share/doc/qt/qtopengl/style/offline.css
/usr/share/doc/qt/qtplatformheaders/qcocoanativecontext-members.html
/usr/share/doc/qt/qtplatformheaders/qcocoanativecontext.html
/usr/share/doc/qt/qtplatformheaders/qcocoawindowfunctions-members.html
/usr/share/doc/qt/qtplatformheaders/qcocoawindowfunctions.html
/usr/share/doc/qt/qtplatformheaders/qeglfsfunctions-members.html
/usr/share/doc/qt/qtplatformheaders/qeglfsfunctions.html
/usr/share/doc/qt/qtplatformheaders/qeglnativecontext-members.html
/usr/share/doc/qt/qtplatformheaders/qeglnativecontext.html
/usr/share/doc/qt/qtplatformheaders/qglxnativecontext-members.html
/usr/share/doc/qt/qtplatformheaders/qglxnativecontext.html
/usr/share/doc/qt/qtplatformheaders/qtplatformheaders-index.html
/usr/share/doc/qt/qtplatformheaders/qtplatformheaders-module.html
/usr/share/doc/qt/qtplatformheaders/qtplatformheaders.index
/usr/share/doc/qt/qtplatformheaders/qtplatformheaders.qhp
/usr/share/doc/qt/qtplatformheaders/qtplatformheaders.qhp.sha1
/usr/share/doc/qt/qtplatformheaders/qtplatformheaders.tags
/usr/share/doc/qt/qtplatformheaders/qwglnativecontext-members.html
/usr/share/doc/qt/qtplatformheaders/qwglnativecontext.html
/usr/share/doc/qt/qtplatformheaders/qwindowswindowfunctions-members.html
/usr/share/doc/qt/qtplatformheaders/qwindowswindowfunctions.html
/usr/share/doc/qt/qtplatformheaders/qxcbwindowfunctions-members.html
/usr/share/doc/qt/qtplatformheaders/qxcbwindowfunctions.html
/usr/share/doc/qt/qtplatformheaders/images/arrow_bc.png
/usr/share/doc/qt/qtplatformheaders/images/bgrContent.png
/usr/share/doc/qt/qtplatformheaders/images/btn_next.png
/usr/share/doc/qt/qtplatformheaders/images/btn_prev.png
/usr/share/doc/qt/qtplatformheaders/images/bullet_dn.png
/usr/share/doc/qt/qtplatformheaders/images/bullet_sq.png
/usr/share/doc/qt/qtplatformheaders/images/home.png
/usr/share/doc/qt/qtplatformheaders/images/ico_note.png
/usr/share/doc/qt/qtplatformheaders/images/ico_note_attention.png
/usr/share/doc/qt/qtplatformheaders/images/ico_out.png
/usr/share/doc/qt/qtplatformheaders/images/logo.png
/usr/share/doc/qt/qtplatformheaders/style/offline-simple.css
/usr/share/doc/qt/qtplatformheaders/style/offline.css
/usr/share/doc/qt/qtpositioning/examples-manifest.xml
/usr/share/doc/qt/qtpositioning/location-positioning-cpp.html
/usr/share/doc/qt/qtpositioning/location-positioning-qml.html
/usr/share/doc/qt/qtpositioning/positioning-cpp-qml.html
/usr/share/doc/qt/qtpositioning/qgeoaddress-members.html
/usr/share/doc/qt/qtpositioning/qgeoaddress.html
/usr/share/doc/qt/qtpositioning/qgeoareamonitorinfo-members.html
/usr/share/doc/qt/qtpositioning/qgeoareamonitorinfo.html
/usr/share/doc/qt/qtpositioning/qgeoareamonitorsource-members.html
/usr/share/doc/qt/qtpositioning/qgeoareamonitorsource.html
/usr/share/doc/qt/qtpositioning/qgeocircle-members.html
/usr/share/doc/qt/qtpositioning/qgeocircle.html
/usr/share/doc/qt/qtpositioning/qgeocoordinate-members.html
/usr/share/doc/qt/qtpositioning/qgeocoordinate.html
/usr/share/doc/qt/qtpositioning/qgeolocation-members.html
/usr/share/doc/qt/qtpositioning/qgeolocation.html
/usr/share/doc/qt/qtpositioning/qgeopath-members.html
/usr/share/doc/qt/qtpositioning/qgeopath.html
/usr/share/doc/qt/qtpositioning/qgeopolygon-members.html
/usr/share/doc/qt/qtpositioning/qgeopolygon.html
/usr/share/doc/qt/qtpositioning/qgeopositioninfo-members.html
/usr/share/doc/qt/qtpositioning/qgeopositioninfo.html
/usr/share/doc/qt/qtpositioning/qgeopositioninfosource-members.html
/usr/share/doc/qt/qtpositioning/qgeopositioninfosource.html
/usr/share/doc/qt/qtpositioning/qgeopositioninfosourcefactory-members.html
/usr/share/doc/qt/qtpositioning/qgeopositioninfosourcefactory.html
/usr/share/doc/qt/qtpositioning/qgeorectangle-members.html
/usr/share/doc/qt/qtpositioning/qgeorectangle.html
/usr/share/doc/qt/qtpositioning/qgeosatelliteinfo-members.html
/usr/share/doc/qt/qtpositioning/qgeosatelliteinfo.html
/usr/share/doc/qt/qtpositioning/qgeosatelliteinfosource-members.html
/usr/share/doc/qt/qtpositioning/qgeosatelliteinfosource.html
/usr/share/doc/qt/qtpositioning/qgeoshape-members.html
/usr/share/doc/qt/qtpositioning/qgeoshape-obsolete.html
/usr/share/doc/qt/qtpositioning/qgeoshape.html
/usr/share/doc/qt/qtpositioning/qhash-proxy.html
/usr/share/doc/qt/qtpositioning/qml-coordinate.html
/usr/share/doc/qt/qtpositioning/qml-geocircle.html
/usr/share/doc/qt/qtpositioning/qml-geopath.html
/usr/share/doc/qt/qtpositioning/qml-geopolygon.html
/usr/share/doc/qt/qtpositioning/qml-georectangle.html
/usr/share/doc/qt/qtpositioning/qml-geoshape.html
/usr/share/doc/qt/qtpositioning/qml-qtpositioning-address-members.html
/usr/share/doc/qt/qtpositioning/qml-qtpositioning-address.html
/usr/share/doc/qt/qtpositioning/qml-qtpositioning-coordinateanimation-members.html
/usr/share/doc/qt/qtpositioning/qml-qtpositioning-coordinateanimation.html
/usr/share/doc/qt/qtpositioning/qml-qtpositioning-location-members.html
/usr/share/doc/qt/qtpositioning/qml-qtpositioning-location.html
/usr/share/doc/qt/qtpositioning/qml-qtpositioning-position-members.html
/usr/share/doc/qt/qtpositioning/qml-qtpositioning-position.html
/usr/share/doc/qt/qtpositioning/qml-qtpositioning-positionsource-members.html
/usr/share/doc/qt/qtpositioning/qml-qtpositioning-positionsource.html
/usr/share/doc/qt/qtpositioning/qml-qtpositioning-qtpositioning-members.html
/usr/share/doc/qt/qtpositioning/qml-qtpositioning-qtpositioning.html
/usr/share/doc/qt/qtpositioning/qnmeapositioninfosource-members.html
/usr/share/doc/qt/qtpositioning/qnmeapositioninfosource.html
/usr/share/doc/qt/qtpositioning/qtpositioning-attribution-weatherinfo-tango-icons.html
/usr/share/doc/qt/qtpositioning/qtpositioning-attribution-weatherinfo-tango-weather-pack.html
/usr/share/doc/qt/qtpositioning/qtpositioning-examples.html
/usr/share/doc/qt/qtpositioning/qtpositioning-geoflickr-example.html
/usr/share/doc/qt/qtpositioning/qtpositioning-index.html
/usr/share/doc/qt/qtpositioning/qtpositioning-logfilepositionsource-example.html
/usr/share/doc/qt/qtpositioning/qtpositioning-module.html
/usr/share/doc/qt/qtpositioning/qtpositioning-plugins.html
/usr/share/doc/qt/qtpositioning/qtpositioning-qmlmodule.html
/usr/share/doc/qt/qtpositioning/qtpositioning-satelliteinfo-example.html
/usr/share/doc/qt/qtpositioning/qtpositioning-weatherinfo-example.html
/usr/share/doc/qt/qtpositioning/qtpositioning.index
/usr/share/doc/qt/qtpositioning/qtpositioning.qhp
/usr/share/doc/qt/qtpositioning/qtpositioning.qhp.sha1
/usr/share/doc/qt/qtpositioning/qtpositioning.tags
/usr/share/doc/qt/qtpositioning/images/arrow_bc.png
/usr/share/doc/qt/qtpositioning/images/bgrContent.png
/usr/share/doc/qt/qtpositioning/images/btn_next.png
/usr/share/doc/qt/qtpositioning/images/btn_prev.png
/usr/share/doc/qt/qtpositioning/images/bullet_dn.png
/usr/share/doc/qt/qtpositioning/images/bullet_sq.png
/usr/share/doc/qt/qtpositioning/images/example-satelliteinfo.png
/usr/share/doc/qt/qtpositioning/images/example-weatherinfo.png
/usr/share/doc/qt/qtpositioning/images/home.png
/usr/share/doc/qt/qtpositioning/images/ico_note.png
/usr/share/doc/qt/qtpositioning/images/ico_note_attention.png
/usr/share/doc/qt/qtpositioning/images/ico_out.png
/usr/share/doc/qt/qtpositioning/images/logo.png
/usr/share/doc/qt/qtpositioning/images/qml-flickr-1.jpg
/usr/share/doc/qt/qtpositioning/style/offline-simple.css
/usr/share/doc/qt/qtpositioning/style/offline.css
/usr/share/doc/qt/qtprintsupport/pdf-licensing.html
/usr/share/doc/qt/qtprintsupport/printing.html
/usr/share/doc/qt/qtprintsupport/qabstractprintdialog-members.html
/usr/share/doc/qt/qtprintsupport/qabstractprintdialog-obsolete.html
/usr/share/doc/qt/qtprintsupport/qabstractprintdialog.html
/usr/share/doc/qt/qtprintsupport/qpagesetupdialog-members.html
/usr/share/doc/qt/qtprintsupport/qpagesetupdialog.html
/usr/share/doc/qt/qtprintsupport/qprintdialog-members.html
/usr/share/doc/qt/qtprintsupport/qprintdialog.html
/usr/share/doc/qt/qtprintsupport/qprintengine-members.html
/usr/share/doc/qt/qtprintsupport/qprintengine.html
/usr/share/doc/qt/qtprintsupport/qprinter-members.html
/usr/share/doc/qt/qtprintsupport/qprinter-obsolete.html
/usr/share/doc/qt/qtprintsupport/qprinter.html
/usr/share/doc/qt/qtprintsupport/qprinterinfo-members.html
/usr/share/doc/qt/qtprintsupport/qprinterinfo-obsolete.html
/usr/share/doc/qt/qtprintsupport/qprinterinfo.html
/usr/share/doc/qt/qtprintsupport/qprintpreviewdialog-members.html
/usr/share/doc/qt/qtprintsupport/qprintpreviewdialog.html
/usr/share/doc/qt/qtprintsupport/qprintpreviewwidget-members.html
/usr/share/doc/qt/qtprintsupport/qprintpreviewwidget.html
/usr/share/doc/qt/qtprintsupport/qtprintsupport-index.html
/usr/share/doc/qt/qtprintsupport/qtprintsupport-module.html
/usr/share/doc/qt/qtprintsupport/qtprintsupport.index
/usr/share/doc/qt/qtprintsupport/qtprintsupport.qhp
/usr/share/doc/qt/qtprintsupport/qtprintsupport.qhp.sha1
/usr/share/doc/qt/qtprintsupport/qtprintsupport.tags
/usr/share/doc/qt/qtprintsupport/images/arrow_bc.png
/usr/share/doc/qt/qtprintsupport/images/bgrContent.png
/usr/share/doc/qt/qtprintsupport/images/btn_next.png
/usr/share/doc/qt/qtprintsupport/images/btn_prev.png
/usr/share/doc/qt/qtprintsupport/images/bullet_dn.png
/usr/share/doc/qt/qtprintsupport/images/bullet_sq.png
/usr/share/doc/qt/qtprintsupport/images/home.png
/usr/share/doc/qt/qtprintsupport/images/ico_note.png
/usr/share/doc/qt/qtprintsupport/images/ico_note_attention.png
/usr/share/doc/qt/qtprintsupport/images/ico_out.png
/usr/share/doc/qt/qtprintsupport/images/logo.png
/usr/share/doc/qt/qtprintsupport/images/plastique-printdialog-properties.png
/usr/share/doc/qt/qtprintsupport/images/plastique-printdialog.png
/usr/share/doc/qt/qtprintsupport/images/printer-rects.png
/usr/share/doc/qt/qtprintsupport/style/offline-simple.css
/usr/share/doc/qt/qtprintsupport/style/offline.css
/usr/share/doc/qt/qtpurchasing/examples-manifest.xml
/usr/share/doc/qt/qtpurchasing/qinappproduct-members.html
/usr/share/doc/qt/qtpurchasing/qinappproduct.html
/usr/share/doc/qt/qtpurchasing/qinappstore-members.html
/usr/share/doc/qt/qtpurchasing/qinappstore.html
/usr/share/doc/qt/qtpurchasing/qinapptransaction-members.html
/usr/share/doc/qt/qtpurchasing/qinapptransaction.html
/usr/share/doc/qt/qtpurchasing/qml-qtpurchasing-product-members.html
/usr/share/doc/qt/qtpurchasing/qml-qtpurchasing-product.html
/usr/share/doc/qt/qtpurchasing/qml-qtpurchasing-store-members.html
/usr/share/doc/qt/qtpurchasing/qml-qtpurchasing-store.html
/usr/share/doc/qt/qtpurchasing/qml-qtpurchasing-transaction-members.html
/usr/share/doc/qt/qtpurchasing/qml-qtpurchasing-transaction.html
/usr/share/doc/qt/qtpurchasing/qtpurchasing-appstore.html
/usr/share/doc/qt/qtpurchasing/qtpurchasing-attribution-base64decoder.html
/usr/share/doc/qt/qtpurchasing/qtpurchasing-attribution-inappservice.html
/usr/share/doc/qt/qtpurchasing/qtpurchasing-attribution-pkeyverify.html
/usr/share/doc/qt/qtpurchasing/qtpurchasing-examples.html
/usr/share/doc/qt/qtpurchasing/qtpurchasing-gettingstarted-cpp.html
/usr/share/doc/qt/qtpurchasing/qtpurchasing-gettingstarted-qml.html
/usr/share/doc/qt/qtpurchasing/qtpurchasing-googleplay.html
/usr/share/doc/qt/qtpurchasing/qtpurchasing-index.html
/usr/share/doc/qt/qtpurchasing/qtpurchasing-module.html
/usr/share/doc/qt/qtpurchasing/qtpurchasing-qmlmodule.html
/usr/share/doc/qt/qtpurchasing/qtpurchasing-qthangman-example.html
/usr/share/doc/qt/qtpurchasing/qtpurchasing-windowsstore.html
/usr/share/doc/qt/qtpurchasing/qtpurchasing.index
/usr/share/doc/qt/qtpurchasing/qtpurchasing.qhp
/usr/share/doc/qt/qtpurchasing/qtpurchasing.qhp.sha1
/usr/share/doc/qt/qtpurchasing/images/arrow_bc.png
/usr/share/doc/qt/qtpurchasing/images/bgrContent.png
/usr/share/doc/qt/qtpurchasing/images/btn_next.png
/usr/share/doc/qt/qtpurchasing/images/btn_prev.png
/usr/share/doc/qt/qtpurchasing/images/bullet_dn.png
/usr/share/doc/qt/qtpurchasing/images/bullet_sq.png
/usr/share/doc/qt/qtpurchasing/images/home.png
/usr/share/doc/qt/qtpurchasing/images/ico_note.png
/usr/share/doc/qt/qtpurchasing/images/ico_note_attention.png
/usr/share/doc/qt/qtpurchasing/images/ico_out.png
/usr/share/doc/qt/qtpurchasing/images/logo.png
/usr/share/doc/qt/qtpurchasing/images/qthangman-example.png
/usr/share/doc/qt/qtpurchasing/images/qthangman-store-example.png
/usr/share/doc/qt/qtpurchasing/style/offline-simple.css
/usr/share/doc/qt/qtpurchasing/style/offline.css
/usr/share/doc/qt/qtqml/examples-manifest.xml
/usr/share/doc/qt/qtqml/qjsengine-members.html
/usr/share/doc/qt/qtqml/qjsengine-obsolete.html
/usr/share/doc/qt/qtqml/qjsengine.html
/usr/share/doc/qt/qtqml/qjsvalue-members.html
/usr/share/doc/qt/qtqml/qjsvalue-obsolete.html
/usr/share/doc/qt/qtqml/qjsvalue.html
/usr/share/doc/qt/qtqml/qjsvalueiterator-members.html
/usr/share/doc/qt/qtqml/qjsvalueiterator.html
/usr/share/doc/qt/qtqml/qml-bool.html
/usr/share/doc/qt/qtqml/qml-date.html
/usr/share/doc/qt/qtqml/qml-double.html
/usr/share/doc/qt/qtqml/qml-enumeration.html
/usr/share/doc/qt/qtqml/qml-int.html
/usr/share/doc/qt/qtqml/qml-list.html
/usr/share/doc/qt/qtqml/qml-package-members.html
/usr/share/doc/qt/qtqml/qml-package.html
/usr/share/doc/qt/qtqml/qml-point.html
/usr/share/doc/qt/qtqml/qml-qt-labs-qmlmodels-delegatechoice-members.html
/usr/share/doc/qt/qtqml/qml-qt-labs-qmlmodels-delegatechoice.html
/usr/share/doc/qt/qtqml/qml-qt-labs-qmlmodels-delegatechooser-members.html
/usr/share/doc/qt/qtqml/qml-qt-labs-qmlmodels-delegatechooser.html
/usr/share/doc/qt/qtqml/qml-qtqml-binding-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-binding.html
/usr/share/doc/qt/qtqml/qml-qtqml-component-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-component.html
/usr/share/doc/qt/qtqml/qml-qtqml-connections-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-connections.html
/usr/share/doc/qt/qtqml/qml-qtqml-date-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-date.html
/usr/share/doc/qt/qtqml/qml-qtqml-instantiator-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-instantiator.html
/usr/share/doc/qt/qtqml/qml-qtqml-locale-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-locale.html
/usr/share/doc/qt/qtqml/qml-qtqml-loggingcategory-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-loggingcategory.html
/usr/share/doc/qt/qtqml/qml-qtqml-models-delegatemodel-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-models-delegatemodel.html
/usr/share/doc/qt/qtqml/qml-qtqml-models-delegatemodelgroup-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-models-delegatemodelgroup.html
/usr/share/doc/qt/qtqml/qml-qtqml-models-itemselectionmodel-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-models-itemselectionmodel.html
/usr/share/doc/qt/qtqml/qml-qtqml-models-listelement-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-models-listelement.html
/usr/share/doc/qt/qtqml/qml-qtqml-models-listmodel-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-models-listmodel.html
/usr/share/doc/qt/qtqml/qml-qtqml-models-objectmodel-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-models-objectmodel.html
/usr/share/doc/qt/qtqml/qml-qtqml-number-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-number.html
/usr/share/doc/qt/qtqml/qml-qtqml-qt-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-qt-obsolete.html
/usr/share/doc/qt/qtqml/qml-qtqml-qt.html
/usr/share/doc/qt/qtqml/qml-qtqml-qtobject-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-qtobject.html
/usr/share/doc/qt/qtqml/qml-qtqml-statemachine-finalstate-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-statemachine-finalstate.html
/usr/share/doc/qt/qtqml/qml-qtqml-statemachine-historystate-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-statemachine-historystate.html
/usr/share/doc/qt/qtqml/qml-qtqml-statemachine-qabstractstate-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-statemachine-qabstractstate.html
/usr/share/doc/qt/qtqml/qml-qtqml-statemachine-qabstracttransition-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-statemachine-qabstracttransition.html
/usr/share/doc/qt/qtqml/qml-qtqml-statemachine-qsignaltransition-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-statemachine-qsignaltransition.html
/usr/share/doc/qt/qtqml/qml-qtqml-statemachine-signaltransition-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-statemachine-signaltransition.html
/usr/share/doc/qt/qtqml/qml-qtqml-statemachine-state-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-statemachine-state.html
/usr/share/doc/qt/qtqml/qml-qtqml-statemachine-statemachine-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-statemachine-statemachine.html
/usr/share/doc/qt/qtqml/qml-qtqml-statemachine-timeouttransition-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-statemachine-timeouttransition.html
/usr/share/doc/qt/qtqml/qml-qtqml-string-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-string.html
/usr/share/doc/qt/qtqml/qml-qtqml-timer-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-timer.html
/usr/share/doc/qt/qtqml/qml-qtqml-workerscript-members.html
/usr/share/doc/qt/qtqml/qml-qtqml-workerscript.html
/usr/share/doc/qt/qtqml/qml-real.html
/usr/share/doc/qt/qtqml/qml-rect.html
/usr/share/doc/qt/qtqml/qml-size.html
/usr/share/doc/qt/qtqml/qml-string.html
/usr/share/doc/qt/qtqml/qml-url.html
/usr/share/doc/qt/qtqml/qml-var.html
/usr/share/doc/qt/qtqml/qml-variant.html
/usr/share/doc/qt/qtqml/qmlextendingexamples.html
/usr/share/doc/qt/qtqml/qmlreference.html
/usr/share/doc/qt/qtqml/qmlstatemachine.html
/usr/share/doc/qt/qtqml/qmodelindex-and-related-classes-in-qml.html
/usr/share/doc/qt/qtqml/qqmlabstracturlinterceptor-members.html
/usr/share/doc/qt/qtqml/qqmlabstracturlinterceptor.html
/usr/share/doc/qt/qtqml/qqmlapplicationengine-members.html
/usr/share/doc/qt/qtqml/qqmlapplicationengine.html
/usr/share/doc/qt/qtqml/qqmlcomponent-members.html
/usr/share/doc/qt/qtqml/qqmlcomponent.html
/usr/share/doc/qt/qtqml/qqmlcontext-members.html
/usr/share/doc/qt/qtqml/qqmlcontext-propertypair.html
/usr/share/doc/qt/qtqml/qqmlcontext.html
/usr/share/doc/qt/qtqml/qqmlengine-members.html
/usr/share/doc/qt/qtqml/qqmlengine.html
/usr/share/doc/qt/qtqml/qqmlerror-members.html
/usr/share/doc/qt/qtqml/qqmlerror.html
/usr/share/doc/qt/qtqml/qqmlexpression-members.html
/usr/share/doc/qt/qtqml/qqmlexpression.html
/usr/share/doc/qt/qtqml/qqmlextensionplugin-members.html
/usr/share/doc/qt/qtqml/qqmlextensionplugin.html
/usr/share/doc/qt/qtqml/qqmlfileselector-members.html
/usr/share/doc/qt/qtqml/qqmlfileselector.html
/usr/share/doc/qt/qtqml/qqmlimageproviderbase-members.html
/usr/share/doc/qt/qtqml/qqmlimageproviderbase.html
/usr/share/doc/qt/qtqml/qqmlincubationcontroller-members.html
/usr/share/doc/qt/qtqml/qqmlincubationcontroller.html
/usr/share/doc/qt/qtqml/qqmlincubator-members.html
/usr/share/doc/qt/qtqml/qqmlincubator.html
/usr/share/doc/qt/qtqml/qqmllistproperty-members.html
/usr/share/doc/qt/qtqml/qqmllistproperty.html
/usr/share/doc/qt/qtqml/qqmllistreference-members.html
/usr/share/doc/qt/qtqml/qqmllistreference.html
/usr/share/doc/qt/qtqml/qqmlnetworkaccessmanagerfactory-members.html
/usr/share/doc/qt/qtqml/qqmlnetworkaccessmanagerfactory.html
/usr/share/doc/qt/qtqml/qqmlparserstatus-members.html
/usr/share/doc/qt/qtqml/qqmlparserstatus.html
/usr/share/doc/qt/qtqml/qqmlproperty-members.html
/usr/share/doc/qt/qtqml/qqmlproperty.html
/usr/share/doc/qt/qtqml/qqmlpropertymap-members.html
/usr/share/doc/qt/qtqml/qqmlpropertymap.html
/usr/share/doc/qt/qtqml/qqmlpropertyvaluesource-members.html
/usr/share/doc/qt/qtqml/qqmlpropertyvaluesource.html
/usr/share/doc/qt/qtqml/qqmlscriptstring-members.html
/usr/share/doc/qt/qtqml/qqmlscriptstring.html
/usr/share/doc/qt/qtqml/qt-labs-qmlmodels-qmlmodule.html
/usr/share/doc/qt/qtqml/qtjavascript.html
/usr/share/doc/qt/qtqml/qtqml-attribution-masm.html
/usr/share/doc/qt/qtqml/qtqml-cppclasses-topic.html
/usr/share/doc/qt/qtqml/qtqml-cppintegration-contextproperties.html
/usr/share/doc/qt/qtqml/qtqml-cppintegration-data.html
/usr/share/doc/qt/qtqml/qtqml-cppintegration-definetypes.html
/usr/share/doc/qt/qtqml/qtqml-cppintegration-exposecppattributes.html
/usr/share/doc/qt/qtqml/qtqml-cppintegration-interactqmlfromcpp.html
/usr/share/doc/qt/qtqml/qtqml-cppintegration-overview.html
/usr/share/doc/qt/qtqml/qtqml-cppintegration-topic.html
/usr/share/doc/qt/qtqml/qtqml-documents-definetypes.html
/usr/share/doc/qt/qtqml/qtqml-documents-networktransparency.html
/usr/share/doc/qt/qtqml/qtqml-documents-scope.html
/usr/share/doc/qt/qtqml/qtqml-documents-structure.html
/usr/share/doc/qt/qtqml/qtqml-documents-topic.html
/usr/share/doc/qt/qtqml/qtqml-dynamicscene-example.html
/usr/share/doc/qt/qtqml/qtqml-index.html
/usr/share/doc/qt/qtqml/qtqml-javascript-dynamicobjectcreation.html
/usr/share/doc/qt/qtqml/qtqml-javascript-expressions.html
/usr/share/doc/qt/qtqml/qtqml-javascript-functionlist.html
/usr/share/doc/qt/qtqml/qtqml-javascript-hostenvironment.html
/usr/share/doc/qt/qtqml/qtqml-javascript-imports.html
/usr/share/doc/qt/qtqml/qtqml-javascript-qmlglobalobject.html
/usr/share/doc/qt/qtqml/qtqml-javascript-resources.html
/usr/share/doc/qt/qtqml/qtqml-javascript-topic.html
/usr/share/doc/qt/qtqml/qtqml-models-qmlmodule.html
/usr/share/doc/qt/qtqml/qtqml-module.html
/usr/share/doc/qt/qtqml/qtqml-modules-cppplugins.html
/usr/share/doc/qt/qtqml/qtqml-modules-identifiedmodules.html
/usr/share/doc/qt/qtqml/qtqml-modules-legacymodules.html
/usr/share/doc/qt/qtqml/qtqml-modules-qmldir.html
/usr/share/doc/qt/qtqml/qtqml-modules-topic.html
/usr/share/doc/qt/qtqml/qtqml-networkaccessmanagerfactory-example.html
/usr/share/doc/qt/qtqml/qtqml-qml-i18n-example.html
/usr/share/doc/qt/qtqml/qtqml-qmlextensionplugins-example.html
/usr/share/doc/qt/qtqml/qtqml-qmlmodule.html
/usr/share/doc/qt/qtqml/qtqml-referenceexamples-adding-example.html
/usr/share/doc/qt/qtqml/qtqml-referenceexamples-attached-example.html
/usr/share/doc/qt/qtqml/qtqml-referenceexamples-binding-example.html
/usr/share/doc/qt/qtqml/qtqml-referenceexamples-coercion-example.html
/usr/share/doc/qt/qtqml/qtqml-referenceexamples-default-example.html
/usr/share/doc/qt/qtqml/qtqml-referenceexamples-extended-example.html
/usr/share/doc/qt/qtqml/qtqml-referenceexamples-grouped-example.html
/usr/share/doc/qt/qtqml/qtqml-referenceexamples-methods-example.html
/usr/share/doc/qt/qtqml/qtqml-referenceexamples-properties-example.html
/usr/share/doc/qt/qtqml/qtqml-referenceexamples-signal-example.html
/usr/share/doc/qt/qtqml/qtqml-referenceexamples-valuesource-example.html
/usr/share/doc/qt/qtqml/qtqml-statemachine-qmlmodule.html
/usr/share/doc/qt/qtqml/qtqml-syntax-basics.html
/usr/share/doc/qt/qtqml/qtqml-syntax-directoryimports.html
/usr/share/doc/qt/qtqml/qtqml-syntax-imports.html
/usr/share/doc/qt/qtqml/qtqml-syntax-objectattributes.html
/usr/share/doc/qt/qtqml/qtqml-syntax-propertybinding.html
/usr/share/doc/qt/qtqml/qtqml-syntax-signals.html
/usr/share/doc/qt/qtqml/qtqml-tutorials-extending-qml-example.html
/usr/share/doc/qt/qtqml/qtqml-typesystem-basictypes.html
/usr/share/doc/qt/qtqml/qtqml-typesystem-objecttypes.html
/usr/share/doc/qt/qtqml/qtqml-typesystem-topic.html
/usr/share/doc/qt/qtqml/qtqml-xmlhttprequest-example.html
/usr/share/doc/qt/qtqml/qtqml.html
/usr/share/doc/qt/qtqml/qtqml.index
/usr/share/doc/qt/qtqml/qtqml.qhp
/usr/share/doc/qt/qtqml/qtqml.qhp.sha1
/usr/share/doc/qt/qtqml/qtqml.tags
/usr/share/doc/qt/qtqml/images/arrow_bc.png
/usr/share/doc/qt/qtqml/images/bgrContent.png
/usr/share/doc/qt/qtqml/images/btn_next.png
/usr/share/doc/qt/qtqml/images/btn_prev.png
/usr/share/doc/qt/qtqml/images/bullet_dn.png
/usr/share/doc/qt/qtqml/images/bullet_sq.png
/usr/share/doc/qt/qtqml/images/button-types.png
/usr/share/doc/qt/qtqml/images/cpp-qml-integration-flowchart.png
/usr/share/doc/qt/qtqml/images/cppintegration-ex.png
/usr/share/doc/qt/qtqml/images/declarative-rect_tint.png
/usr/share/doc/qt/qtqml/images/documents-definetypes-attributes.png
/usr/share/doc/qt/qtqml/images/documents-definetypes-simple.png
/usr/share/doc/qt/qtqml/images/extending-tutorial-chapter1.png
/usr/share/doc/qt/qtqml/images/extending-tutorial-chapter2.png
/usr/share/doc/qt/qtqml/images/extending-tutorial-chapter3.png
/usr/share/doc/qt/qtqml/images/extending-tutorial-chapter5.png
/usr/share/doc/qt/qtqml/images/home.png
/usr/share/doc/qt/qtqml/images/ico_note.png
/usr/share/doc/qt/qtqml/images/ico_note_attention.png
/usr/share/doc/qt/qtqml/images/ico_out.png
/usr/share/doc/qt/qtqml/images/listmodel-nested.png
/usr/share/doc/qt/qtqml/images/listmodel.png
/usr/share/doc/qt/qtqml/images/logo.png
/usr/share/doc/qt/qtqml/images/objectmodel.png
/usr/share/doc/qt/qtqml/images/qml-dynamicscene-example.png
/usr/share/doc/qt/qtqml/images/qml-i18n-example.png
/usr/share/doc/qt/qtqml/images/qml-plugins-example.png
/usr/share/doc/qt/qtqml/images/qml-xmlhttprequest-example.png
/usr/share/doc/qt/qtqml/images/qtqml-syntax-basics-object-declaration.png
/usr/share/doc/qt/qtqml/images/statemachine-button-history.png
/usr/share/doc/qt/qtqml/images/statemachine-button-nested.png
/usr/share/doc/qt/qtqml/images/statemachine-button.png
/usr/share/doc/qt/qtqml/images/statemachine-finished.png
/usr/share/doc/qt/qtqml/images/statemachine-nonparallel.png
/usr/share/doc/qt/qtqml/images/statemachine-parallel.png
/usr/share/doc/qt/qtqml/style/offline-simple.css
/usr/share/doc/qt/qtqml/style/offline.css
/usr/share/doc/qt/qtqmltest/qml-qttest-signalspy-members.html
/usr/share/doc/qt/qtqmltest/qml-qttest-signalspy.html
/usr/share/doc/qt/qtqmltest/qml-qttest-testcase-members.html
/usr/share/doc/qt/qtqmltest/qml-qttest-testcase.html
/usr/share/doc/qt/qtqmltest/qml-qttest-toucheventsequence-members.html
/usr/share/doc/qt/qtqmltest/qml-qttest-toucheventsequence.html
/usr/share/doc/qt/qtqmltest/qquicktest.html
/usr/share/doc/qt/qtqmltest/qtqmltest.index
/usr/share/doc/qt/qtqmltest/qtqmltest.qhp
/usr/share/doc/qt/qtqmltest/qtqmltest.qhp.sha1
/usr/share/doc/qt/qtqmltest/qtqmltest.tags
/usr/share/doc/qt/qtqmltest/qtquicktest-index.html
/usr/share/doc/qt/qtqmltest/qtquicktest-module.html
/usr/share/doc/qt/qtqmltest/qttest-qmlmodule.html
/usr/share/doc/qt/qtqmltest/images/arrow_bc.png
/usr/share/doc/qt/qtqmltest/images/bgrContent.png
/usr/share/doc/qt/qtqmltest/images/btn_next.png
/usr/share/doc/qt/qtqmltest/images/btn_prev.png
/usr/share/doc/qt/qtqmltest/images/bullet_dn.png
/usr/share/doc/qt/qtqmltest/images/bullet_sq.png
/usr/share/doc/qt/qtqmltest/images/home.png
/usr/share/doc/qt/qtqmltest/images/ico_note.png
/usr/share/doc/qt/qtqmltest/images/ico_note_attention.png
/usr/share/doc/qt/qtqmltest/images/ico_out.png
/usr/share/doc/qt/qtqmltest/images/logo.png
/usr/share/doc/qt/qtqmltest/style/offline-simple.css
/usr/share/doc/qt/qtqmltest/style/offline.css
/usr/share/doc/qt/qtquick/examples-manifest.xml
/usr/share/doc/qt/qtquick/qml-advtutorial.html
/usr/share/doc/qt/qtquick/qml-color.html
/usr/share/doc/qt/qtquick/qml-dynamicview-tutorial.html
/usr/share/doc/qt/qtquick/qml-font.html
/usr/share/doc/qt/qtquick/qml-matrix4x4.html
/usr/share/doc/qt/qtquick/qml-qt-labs-folderlistmodel-folderlistmodel-members.html
/usr/share/doc/qt/qtquick/qml-qt-labs-folderlistmodel-folderlistmodel.html
/usr/share/doc/qt/qtquick/qml-qt-labs-settings-settings-members.html
/usr/share/doc/qt/qtquick/qml-qt-labs-settings-settings.html
/usr/share/doc/qt/qtquick/qml-qt-labs-wavefrontmesh-wavefrontmesh-members.html
/usr/share/doc/qt/qtquick/qml-qt-labs-wavefrontmesh-wavefrontmesh.html
/usr/share/doc/qt/qtquick/qml-qtquick-accessible-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-accessible.html
/usr/share/doc/qt/qtquick/qml-qtquick-anchoranimation-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-anchoranimation.html
/usr/share/doc/qt/qtquick/qml-qtquick-anchorchanges-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-anchorchanges.html
/usr/share/doc/qt/qtquick/qml-qtquick-animatedimage-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-animatedimage.html
/usr/share/doc/qt/qtquick/qml-qtquick-animatedsprite-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-animatedsprite.html
/usr/share/doc/qt/qtquick/qml-qtquick-animation-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-animation.html
/usr/share/doc/qt/qtquick/qml-qtquick-animationcontroller-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-animationcontroller.html
/usr/share/doc/qt/qtquick/qml-qtquick-animator-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-animator.html
/usr/share/doc/qt/qtquick/qml-qtquick-behavior-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-behavior.html
/usr/share/doc/qt/qtquick/qml-qtquick-borderimage-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-borderimage.html
/usr/share/doc/qt/qtquick/qml-qtquick-borderimagemesh-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-borderimagemesh.html
/usr/share/doc/qt/qtquick/qml-qtquick-canvas-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-canvas-obsolete.html
/usr/share/doc/qt/qtquick/qml-qtquick-canvas.html
/usr/share/doc/qt/qtquick/qml-qtquick-canvasgradient-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-canvasgradient.html
/usr/share/doc/qt/qtquick/qml-qtquick-canvasimagedata-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-canvasimagedata.html
/usr/share/doc/qt/qtquick/qml-qtquick-canvaspixelarray-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-canvaspixelarray.html
/usr/share/doc/qt/qtquick/qml-qtquick-coloranimation-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-coloranimation.html
/usr/share/doc/qt/qtquick/qml-qtquick-column-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-column.html
/usr/share/doc/qt/qtquick/qml-qtquick-context2d-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-context2d.html
/usr/share/doc/qt/qtquick/qml-qtquick-doublevalidator-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-doublevalidator.html
/usr/share/doc/qt/qtquick/qml-qtquick-drag-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-drag.html
/usr/share/doc/qt/qtquick/qml-qtquick-dragevent-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-dragevent.html
/usr/share/doc/qt/qtquick/qml-qtquick-draghandler-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-draghandler.html
/usr/share/doc/qt/qtquick/qml-qtquick-droparea-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-droparea.html
/usr/share/doc/qt/qtquick/qml-qtquick-enterkey-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-enterkey.html
/usr/share/doc/qt/qtquick/qml-qtquick-eventpoint-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-eventpoint.html
/usr/share/doc/qt/qtquick/qml-qtquick-eventtouchpoint-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-eventtouchpoint.html
/usr/share/doc/qt/qtquick/qml-qtquick-flickable-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-flickable.html
/usr/share/doc/qt/qtquick/qml-qtquick-flipable-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-flipable.html
/usr/share/doc/qt/qtquick/qml-qtquick-flow-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-flow.html
/usr/share/doc/qt/qtquick/qml-qtquick-focusscope-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-focusscope.html
/usr/share/doc/qt/qtquick/qml-qtquick-fontloader-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-fontloader.html
/usr/share/doc/qt/qtquick/qml-qtquick-fontmetrics-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-fontmetrics.html
/usr/share/doc/qt/qtquick/qml-qtquick-gestureevent-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-gestureevent.html
/usr/share/doc/qt/qtquick/qml-qtquick-gradient-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-gradient.html
/usr/share/doc/qt/qtquick/qml-qtquick-gradientstop-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-gradientstop.html
/usr/share/doc/qt/qtquick/qml-qtquick-graphicsinfo-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-graphicsinfo.html
/usr/share/doc/qt/qtquick/qml-qtquick-grid-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-grid.html
/usr/share/doc/qt/qtquick/qml-qtquick-gridmesh-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-gridmesh.html
/usr/share/doc/qt/qtquick/qml-qtquick-gridview-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-gridview.html
/usr/share/doc/qt/qtquick/qml-qtquick-handlerpoint-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-handlerpoint.html
/usr/share/doc/qt/qtquick/qml-qtquick-hoverhandler-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-hoverhandler.html
/usr/share/doc/qt/qtquick/qml-qtquick-image-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-image.html
/usr/share/doc/qt/qtquick/qml-qtquick-intvalidator-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-intvalidator.html
/usr/share/doc/qt/qtquick/qml-qtquick-item-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-item.html
/usr/share/doc/qt/qtquick/qml-qtquick-itemgrabresult-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-itemgrabresult.html
/usr/share/doc/qt/qtquick/qml-qtquick-keyevent-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-keyevent.html
/usr/share/doc/qt/qtquick/qml-qtquick-keynavigation-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-keynavigation.html
/usr/share/doc/qt/qtquick/qml-qtquick-keys-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-keys.html
/usr/share/doc/qt/qtquick/qml-qtquick-layoutmirroring-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-layoutmirroring.html
/usr/share/doc/qt/qtquick/qml-qtquick-layouts-columnlayout-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-layouts-columnlayout.html
/usr/share/doc/qt/qtquick/qml-qtquick-layouts-gridlayout-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-layouts-gridlayout.html
/usr/share/doc/qt/qtquick/qml-qtquick-layouts-layout-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-layouts-layout.html
/usr/share/doc/qt/qtquick/qml-qtquick-layouts-rowlayout-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-layouts-rowlayout.html
/usr/share/doc/qt/qtquick/qml-qtquick-layouts-stacklayout-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-layouts-stacklayout.html
/usr/share/doc/qt/qtquick/qml-qtquick-listview-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-listview.html
/usr/share/doc/qt/qtquick/qml-qtquick-loader-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-loader.html
/usr/share/doc/qt/qtquick/qml-qtquick-matrix4x4-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-matrix4x4.html
/usr/share/doc/qt/qtquick/qml-qtquick-mousearea-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-mousearea.html
/usr/share/doc/qt/qtquick/qml-qtquick-mouseevent-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-mouseevent.html
/usr/share/doc/qt/qtquick/qml-qtquick-multipointhandler-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-multipointhandler.html
/usr/share/doc/qt/qtquick/qml-qtquick-multipointtoucharea-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-multipointtoucharea.html
/usr/share/doc/qt/qtquick/qml-qtquick-numberanimation-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-numberanimation.html
/usr/share/doc/qt/qtquick/qml-qtquick-opacityanimator-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-opacityanimator.html
/usr/share/doc/qt/qtquick/qml-qtquick-openglinfo-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-openglinfo.html
/usr/share/doc/qt/qtquick/qml-qtquick-parallelanimation-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-parallelanimation.html
/usr/share/doc/qt/qtquick/qml-qtquick-parentanimation-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-parentanimation.html
/usr/share/doc/qt/qtquick/qml-qtquick-parentchange-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-parentchange.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-affector-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-affector.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-age-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-age.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-angledirection-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-angledirection.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-attractor-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-attractor.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-cumulativedirection-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-cumulativedirection.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-customparticle-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-customparticle.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-direction-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-direction.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-ellipseshape-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-ellipseshape.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-emitter-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-emitter.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-friction-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-friction.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-gravity-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-gravity-obsolete.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-gravity.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-groupgoal-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-groupgoal.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-imageparticle-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-imageparticle.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-itemparticle-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-itemparticle.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-lineshape-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-lineshape.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-maskshape-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-maskshape.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-particle-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-particle.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-particlegroup-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-particlegroup.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-particlepainter-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-particlepainter.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-particlesystem-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-particlesystem.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-pointdirection-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-pointdirection.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-rectangleshape-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-rectangleshape.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-spritegoal-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-spritegoal.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-targetdirection-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-targetdirection.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-trailemitter-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-trailemitter.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-turbulence-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-turbulence.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-wander-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-particles-wander.html
/usr/share/doc/qt/qtquick/qml-qtquick-path-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-path.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathanglearc-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathanglearc.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathanimation-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathanimation.html
/usr/share/doc/qt/qtquick/qml-qtquick-patharc-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-patharc.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathattribute-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathattribute.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathcubic-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathcubic.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathcurve-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathcurve.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathelement-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathelement.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathinterpolator-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathinterpolator.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathline-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathline.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathmove-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathmove.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathpercent-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathpercent.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathquad-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathquad.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathsvg-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathsvg.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathview-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-pathview.html
/usr/share/doc/qt/qtquick/qml-qtquick-pauseanimation-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-pauseanimation.html
/usr/share/doc/qt/qtquick/qml-qtquick-pincharea-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-pincharea.html
/usr/share/doc/qt/qtquick/qml-qtquick-pinchevent-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-pinchevent.html
/usr/share/doc/qt/qtquick/qml-qtquick-pinchhandler-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-pinchhandler.html
/usr/share/doc/qt/qtquick/qml-qtquick-pointerdevice-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-pointerdevice.html
/usr/share/doc/qt/qtquick/qml-qtquick-pointerdevicehandler-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-pointerdevicehandler.html
/usr/share/doc/qt/qtquick/qml-qtquick-pointerevent-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-pointerevent.html
/usr/share/doc/qt/qtquick/qml-qtquick-pointerhandler-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-pointerhandler.html
/usr/share/doc/qt/qtquick/qml-qtquick-pointhandler-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-pointhandler.html
/usr/share/doc/qt/qtquick/qml-qtquick-positioner-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-positioner.html
/usr/share/doc/qt/qtquick/qml-qtquick-propertyaction-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-propertyaction.html
/usr/share/doc/qt/qtquick/qml-qtquick-propertyanimation-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-propertyanimation.html
/usr/share/doc/qt/qtquick/qml-qtquick-propertychanges-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-propertychanges.html
/usr/share/doc/qt/qtquick/qml-qtquick-rectangle-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-rectangle.html
/usr/share/doc/qt/qtquick/qml-qtquick-regexpvalidator-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-regexpvalidator.html
/usr/share/doc/qt/qtquick/qml-qtquick-repeater-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-repeater.html
/usr/share/doc/qt/qtquick/qml-qtquick-rotation-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-rotation.html
/usr/share/doc/qt/qtquick/qml-qtquick-rotationanimation-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-rotationanimation.html
/usr/share/doc/qt/qtquick/qml-qtquick-rotationanimator-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-rotationanimator.html
/usr/share/doc/qt/qtquick/qml-qtquick-row-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-row.html
/usr/share/doc/qt/qtquick/qml-qtquick-scale-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-scale.html
/usr/share/doc/qt/qtquick/qml-qtquick-scaleanimator-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-scaleanimator.html
/usr/share/doc/qt/qtquick/qml-qtquick-scriptaction-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-scriptaction.html
/usr/share/doc/qt/qtquick/qml-qtquick-sequentialanimation-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-sequentialanimation.html
/usr/share/doc/qt/qtquick/qml-qtquick-shadereffect-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-shadereffect.html
/usr/share/doc/qt/qtquick/qml-qtquick-shadereffectsource-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-shadereffectsource.html
/usr/share/doc/qt/qtquick/qml-qtquick-shapes-conicalgradient-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-shapes-conicalgradient.html
/usr/share/doc/qt/qtquick/qml-qtquick-shapes-lineargradient-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-shapes-lineargradient.html
/usr/share/doc/qt/qtquick/qml-qtquick-shapes-radialgradient-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-shapes-radialgradient.html
/usr/share/doc/qt/qtquick/qml-qtquick-shapes-shape-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-shapes-shape.html
/usr/share/doc/qt/qtquick/qml-qtquick-shapes-shapegradient-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-shapes-shapegradient.html
/usr/share/doc/qt/qtquick/qml-qtquick-shapes-shapepath-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-shapes-shapepath.html
/usr/share/doc/qt/qtquick/qml-qtquick-shortcut-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-shortcut.html
/usr/share/doc/qt/qtquick/qml-qtquick-singlepointhandler-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-singlepointhandler.html
/usr/share/doc/qt/qtquick/qml-qtquick-smoothedanimation-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-smoothedanimation.html
/usr/share/doc/qt/qtquick/qml-qtquick-springanimation-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-springanimation.html
/usr/share/doc/qt/qtquick/qml-qtquick-sprite-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-sprite.html
/usr/share/doc/qt/qtquick/qml-qtquick-spritesequence-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-spritesequence.html
/usr/share/doc/qt/qtquick/qml-qtquick-state-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-state.html
/usr/share/doc/qt/qtquick/qml-qtquick-statechangescript-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-statechangescript.html
/usr/share/doc/qt/qtquick/qml-qtquick-stategroup-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-stategroup.html
/usr/share/doc/qt/qtquick/qml-qtquick-systempalette-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-systempalette.html
/usr/share/doc/qt/qtquick/qml-qtquick-tableview-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-tableview.html
/usr/share/doc/qt/qtquick/qml-qtquick-taphandler-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-taphandler.html
/usr/share/doc/qt/qtquick/qml-qtquick-text-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-text-obsolete.html
/usr/share/doc/qt/qtquick/qml-qtquick-text.html
/usr/share/doc/qt/qtquick/qml-qtquick-textedit-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-textedit.html
/usr/share/doc/qt/qtquick/qml-qtquick-textinput-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-textinput.html
/usr/share/doc/qt/qtquick/qml-qtquick-textmetrics-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-textmetrics.html
/usr/share/doc/qt/qtquick/qml-qtquick-touchpoint-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-touchpoint-obsolete.html
/usr/share/doc/qt/qtquick/qml-qtquick-touchpoint.html
/usr/share/doc/qt/qtquick/qml-qtquick-transform-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-transform.html
/usr/share/doc/qt/qtquick/qml-qtquick-transition-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-transition.html
/usr/share/doc/qt/qtquick/qml-qtquick-translate-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-translate.html
/usr/share/doc/qt/qtquick/qml-qtquick-uniformanimator-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-uniformanimator.html
/usr/share/doc/qt/qtquick/qml-qtquick-vector3danimation-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-vector3danimation.html
/usr/share/doc/qt/qtquick/qml-qtquick-viewtransition-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-viewtransition.html
/usr/share/doc/qt/qtquick/qml-qtquick-wheelevent-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-wheelevent.html
/usr/share/doc/qt/qtquick/qml-qtquick-window-closeevent-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-window-closeevent.html
/usr/share/doc/qt/qtquick/qml-qtquick-window-screen-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-window-screen-obsolete.html
/usr/share/doc/qt/qtquick/qml-qtquick-window-screen.html
/usr/share/doc/qt/qtquick/qml-qtquick-window-window-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-window-window.html
/usr/share/doc/qt/qtquick/qml-qtquick-xanimator-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-xanimator.html
/usr/share/doc/qt/qtquick/qml-qtquick-yanimator-members.html
/usr/share/doc/qt/qtquick/qml-qtquick-yanimator.html
/usr/share/doc/qt/qtquick/qml-quaternion.html
/usr/share/doc/qt/qtquick/qml-signalspy-members.html
/usr/share/doc/qt/qtquick/qml-signalspy.html
/usr/share/doc/qt/qtquick/qml-testcase-members.html
/usr/share/doc/qt/qtquick/qml-testcase.html
/usr/share/doc/qt/qtquick/qml-toucheventsequence-members.html
/usr/share/doc/qt/qtquick/qml-toucheventsequence.html
/usr/share/doc/qt/qtquick/qml-tutorial.html
/usr/share/doc/qt/qtquick/qml-tutorial1.html
/usr/share/doc/qt/qtquick/qml-tutorial2.html
/usr/share/doc/qt/qtquick/qml-tutorial3.html
/usr/share/doc/qt/qtquick/qml-vector2d.html
/usr/share/doc/qt/qtquick/qml-vector3d.html
/usr/share/doc/qt/qtquick/qml-vector4d.html
/usr/share/doc/qt/qtquick/qmlexampletoggleswitch.html
/usr/share/doc/qt/qtquick/qquickasyncimageprovider-members.html
/usr/share/doc/qt/qtquick/qquickasyncimageprovider.html
/usr/share/doc/qt/qtquick/qquickframebufferobject-members.html
/usr/share/doc/qt/qtquick/qquickframebufferobject-renderer-members.html
/usr/share/doc/qt/qtquick/qquickframebufferobject-renderer.html
/usr/share/doc/qt/qtquick/qquickframebufferobject.html
/usr/share/doc/qt/qtquick/qquickimageprovider-members.html
/usr/share/doc/qt/qtquick/qquickimageprovider.html
/usr/share/doc/qt/qtquick/qquickimageresponse-members.html
/usr/share/doc/qt/qtquick/qquickimageresponse.html
/usr/share/doc/qt/qtquick/qquickitem-itemchangedata-members.html
/usr/share/doc/qt/qtquick/qquickitem-itemchangedata.html
/usr/share/doc/qt/qtquick/qquickitem-members.html
/usr/share/doc/qt/qtquick/qquickitem.html
/usr/share/doc/qt/qtquick/qquickitemgrabresult-members.html
/usr/share/doc/qt/qtquick/qquickitemgrabresult.html
/usr/share/doc/qt/qtquick/qquickpainteditem-members.html
/usr/share/doc/qt/qtquick/qquickpainteditem-obsolete.html
/usr/share/doc/qt/qtquick/qquickpainteditem.html
/usr/share/doc/qt/qtquick/qquickrendercontrol-members.html
/usr/share/doc/qt/qtquick/qquickrendercontrol.html
/usr/share/doc/qt/qtquick/qquicktextdocument-members.html
/usr/share/doc/qt/qtquick/qquicktextdocument.html
/usr/share/doc/qt/qtquick/qquicktexturefactory-members.html
/usr/share/doc/qt/qtquick/qquicktexturefactory.html
/usr/share/doc/qt/qtquick/qquickview-members.html
/usr/share/doc/qt/qtquick/qquickview.html
/usr/share/doc/qt/qtquick/qquickwidget-members.html
/usr/share/doc/qt/qtquick/qquickwidget.html
/usr/share/doc/qt/qtquick/qquickwindow-members.html
/usr/share/doc/qt/qtquick/qquickwindow-obsolete.html
/usr/share/doc/qt/qtquick/qquickwindow.html
/usr/share/doc/qt/qtquick/qsgabstractrenderer-members.html
/usr/share/doc/qt/qtquick/qsgabstractrenderer.html
/usr/share/doc/qt/qtquick/qsgbasicgeometrynode-members.html
/usr/share/doc/qt/qtquick/qsgbasicgeometrynode.html
/usr/share/doc/qt/qtquick/qsgclipnode-members.html
/usr/share/doc/qt/qtquick/qsgclipnode.html
/usr/share/doc/qt/qtquick/qsgdynamictexture-members.html
/usr/share/doc/qt/qtquick/qsgdynamictexture.html
/usr/share/doc/qt/qtquick/qsgengine-members.html
/usr/share/doc/qt/qtquick/qsgengine.html
/usr/share/doc/qt/qtquick/qsgflatcolormaterial-members.html
/usr/share/doc/qt/qtquick/qsgflatcolormaterial.html
/usr/share/doc/qt/qtquick/qsggeometry-attribute-members.html
/usr/share/doc/qt/qtquick/qsggeometry-attribute.html
/usr/share/doc/qt/qtquick/qsggeometry-attributeset.html
/usr/share/doc/qt/qtquick/qsggeometry-coloredpoint2d-members.html
/usr/share/doc/qt/qtquick/qsggeometry-coloredpoint2d.html
/usr/share/doc/qt/qtquick/qsggeometry-members.html
/usr/share/doc/qt/qtquick/qsggeometry-point2d-members.html
/usr/share/doc/qt/qtquick/qsggeometry-point2d.html
/usr/share/doc/qt/qtquick/qsggeometry-texturedpoint2d-members.html
/usr/share/doc/qt/qtquick/qsggeometry-texturedpoint2d.html
/usr/share/doc/qt/qtquick/qsggeometry.html
/usr/share/doc/qt/qtquick/qsggeometrynode-members.html
/usr/share/doc/qt/qtquick/qsggeometrynode.html
/usr/share/doc/qt/qtquick/qsgimagenode-members.html
/usr/share/doc/qt/qtquick/qsgimagenode.html
/usr/share/doc/qt/qtquick/qsgmaterial-members.html
/usr/share/doc/qt/qtquick/qsgmaterial.html
/usr/share/doc/qt/qtquick/qsgmaterialshader-members.html
/usr/share/doc/qt/qtquick/qsgmaterialshader-renderstate-members.html
/usr/share/doc/qt/qtquick/qsgmaterialshader-renderstate.html
/usr/share/doc/qt/qtquick/qsgmaterialshader.html
/usr/share/doc/qt/qtquick/qsgmaterialtype.html
/usr/share/doc/qt/qtquick/qsgnode-members.html
/usr/share/doc/qt/qtquick/qsgnode.html
/usr/share/doc/qt/qtquick/qsgopacitynode-members.html
/usr/share/doc/qt/qtquick/qsgopacitynode.html
/usr/share/doc/qt/qtquick/qsgopaquetexturematerial-members.html
/usr/share/doc/qt/qtquick/qsgopaquetexturematerial.html
/usr/share/doc/qt/qtquick/qsgrectanglenode-members.html
/usr/share/doc/qt/qtquick/qsgrectanglenode.html
/usr/share/doc/qt/qtquick/qsgrendererinterface-members.html
/usr/share/doc/qt/qtquick/qsgrendererinterface.html
/usr/share/doc/qt/qtquick/qsgrendernode-members.html
/usr/share/doc/qt/qtquick/qsgrendernode.html
/usr/share/doc/qt/qtquick/qsgsimplematerial-members.html
/usr/share/doc/qt/qtquick/qsgsimplematerial.html
/usr/share/doc/qt/qtquick/qsgsimplematerialshader-members.html
/usr/share/doc/qt/qtquick/qsgsimplematerialshader.html
/usr/share/doc/qt/qtquick/qsgsimplerectnode-members.html
/usr/share/doc/qt/qtquick/qsgsimplerectnode.html
/usr/share/doc/qt/qtquick/qsgsimpletexturenode-members.html
/usr/share/doc/qt/qtquick/qsgsimpletexturenode.html
/usr/share/doc/qt/qtquick/qsgtexture-members.html
/usr/share/doc/qt/qtquick/qsgtexture.html
/usr/share/doc/qt/qtquick/qsgtexturematerial-members.html
/usr/share/doc/qt/qtquick/qsgtexturematerial.html
/usr/share/doc/qt/qtquick/qsgtextureprovider-members.html
/usr/share/doc/qt/qtquick/qsgtextureprovider.html
/usr/share/doc/qt/qtquick/qsgtransformnode-members.html
/usr/share/doc/qt/qtquick/qsgtransformnode.html
/usr/share/doc/qt/qtquick/qsgvertexcolormaterial-members.html
/usr/share/doc/qt/qtquick/qsgvertexcolormaterial.html
/usr/share/doc/qt/qtquick/qt-labs-folderlistmodel-qmlmodule.html
/usr/share/doc/qt/qtquick/qt-labs-qmlmodels-qmlmodule.html
/usr/share/doc/qt/qtquick/qt-labs-settings-qmlmodule.html
/usr/share/doc/qt/qtquick/qt-labs-sharedimage-qmlmodule.html
/usr/share/doc/qt/qtquick/qt-labs-wavefrontmesh-qmlmodule.html
/usr/share/doc/qt/qtquick/qtquick-animation-example.html
/usr/share/doc/qt/qtquick/qtquick-bestpractices.html
/usr/share/doc/qt/qtquick/qtquick-canvas-example.html
/usr/share/doc/qt/qtquick/qtquick-codesamples.html
/usr/share/doc/qt/qtquick/qtquick-convenience-topic.html
/usr/share/doc/qt/qtquick/qtquick-cppextensionpoints.html
/usr/share/doc/qt/qtquick/qtquick-customitems-dialcontrol-example.html
/usr/share/doc/qt/qtquick/qtquick-customitems-flipable-example.html
/usr/share/doc/qt/qtquick/qtquick-customitems-painteditem-example.html
/usr/share/doc/qt/qtquick/qtquick-customitems-scrollbar-example.html
/usr/share/doc/qt/qtquick/qtquick-customitems-tabwidget-example.html
/usr/share/doc/qt/qtquick/qtquick-draganddrop-example.html
/usr/share/doc/qt/qtquick/qtquick-effects-particles.html
/usr/share/doc/qt/qtquick/qtquick-effects-sprites.html
/usr/share/doc/qt/qtquick/qtquick-effects-topic.html
/usr/share/doc/qt/qtquick/qtquick-effects-transformations.html
/usr/share/doc/qt/qtquick/qtquick-externaldraganddrop-example.html
/usr/share/doc/qt/qtquick/qtquick-imageelements-example.html
/usr/share/doc/qt/qtquick/qtquick-imageprovider-example.html
/usr/share/doc/qt/qtquick/qtquick-imageresponseprovider-example.html
/usr/share/doc/qt/qtquick/qtquick-index.html
/usr/share/doc/qt/qtquick/qtquick-input-focus.html
/usr/share/doc/qt/qtquick/qtquick-input-mouseevents.html
/usr/share/doc/qt/qtquick/qtquick-input-textinput.html
/usr/share/doc/qt/qtquick/qtquick-input-topic.html
/usr/share/doc/qt/qtquick/qtquick-keyinteraction-example.html
/usr/share/doc/qt/qtquick/qtquick-layouts-example.html
/usr/share/doc/qt/qtquick/qtquick-layouts-qmlmodule.html
/usr/share/doc/qt/qtquick/qtquick-localstorage-example.html
/usr/share/doc/qt/qtquick/qtquick-localstorage-qmlmodule.html
/usr/share/doc/qt/qtquick/qtquick-models-abstractitemmodel-example.html
/usr/share/doc/qt/qtquick/qtquick-models-objectlistmodel-example.html
/usr/share/doc/qt/qtquick/qtquick-models-stringlistmodel-example.html
/usr/share/doc/qt/qtquick/qtquick-modelviewsdata-cppmodels.html
/usr/share/doc/qt/qtquick/qtquick-modelviewsdata-modelview.html
/usr/share/doc/qt/qtquick/qtquick-modelviewsdata-topic.html
/usr/share/doc/qt/qtquick/qtquick-module.html
/usr/share/doc/qt/qtquick/qtquick-mousearea-example.html
/usr/share/doc/qt/qtquick/qtquick-particles-affectors-example.html
/usr/share/doc/qt/qtquick/qtquick-particles-customparticle-example.html
/usr/share/doc/qt/qtquick/qtquick-particles-emitters-example.html
/usr/share/doc/qt/qtquick/qtquick-particles-imageparticle-example.html
/usr/share/doc/qt/qtquick/qtquick-particles-performance.html
/usr/share/doc/qt/qtquick/qtquick-particles-qmlmodule.html
/usr/share/doc/qt/qtquick/qtquick-particles-system-example.html
/usr/share/doc/qt/qtquick/qtquick-positioners-example.html
/usr/share/doc/qt/qtquick/qtquick-positioning-anchors.html
/usr/share/doc/qt/qtquick/qtquick-positioning-layouts.html
/usr/share/doc/qt/qtquick/qtquick-positioning-righttoleft.html
/usr/share/doc/qt/qtquick/qtquick-positioning-topic.html
/usr/share/doc/qt/qtquick/qtquick-qmlmodule.html
/usr/share/doc/qt/qtquick/qtquick-quick-accessibility-example.html
/usr/share/doc/qt/qtquick/qtquick-quickwidgets-quickwidget-example.html
/usr/share/doc/qt/qtquick/qtquick-rendercontrol-example.html
/usr/share/doc/qt/qtquick/qtquick-righttoleft-example.html
/usr/share/doc/qt/qtquick/qtquick-scenegraph-customgeometry-example.html
/usr/share/doc/qt/qtquick/qtquick-scenegraph-graph-example.html
/usr/share/doc/qt/qtquick/qtquick-scenegraph-materials.html
/usr/share/doc/qt/qtquick/qtquick-scenegraph-nodes.html
/usr/share/doc/qt/qtquick/qtquick-scenegraph-openglunderqml-example.html
/usr/share/doc/qt/qtquick/qtquick-scenegraph-simplematerial-example.html
/usr/share/doc/qt/qtquick/qtquick-scenegraph-textureinsgnode-example.html
/usr/share/doc/qt/qtquick/qtquick-scenegraph-textureinthread-example.html
/usr/share/doc/qt/qtquick/qtquick-scenegraph-twotextureproviders-example.html
/usr/share/doc/qt/qtquick/qtquick-shadereffects-example.html
/usr/share/doc/qt/qtquick/qtquick-shapes-example.html
/usr/share/doc/qt/qtquick/qtquick-shapes-qmlmodule.html
/usr/share/doc/qt/qtquick/qtquick-statesanimations-animations.html
/usr/share/doc/qt/qtquick/qtquick-statesanimations-behaviors.html
/usr/share/doc/qt/qtquick/qtquick-statesanimations-states.html
/usr/share/doc/qt/qtquick/qtquick-statesanimations-topic.html
/usr/share/doc/qt/qtquick/qtquick-tableview-gameoflife-example.html
/usr/share/doc/qt/qtquick/qtquick-tableview-pixelator-example.html
/usr/share/doc/qt/qtquick/qtquick-text-example.html
/usr/share/doc/qt/qtquick/qtquick-text-validator.html
/usr/share/doc/qt/qtquick/qtquick-threading-example.html
/usr/share/doc/qt/qtquick/qtquick-threading-threadedlistmodel-example.html
/usr/share/doc/qt/qtquick/qtquick-tools-and-utilities.html
/usr/share/doc/qt/qtquick/qtquick-touchinteraction-example.html
/usr/share/doc/qt/qtquick/qtquick-tutorials-dynamicview-dynamicview1-example.html
/usr/share/doc/qt/qtquick/qtquick-tutorials-dynamicview-dynamicview2-example.html
/usr/share/doc/qt/qtquick/qtquick-tutorials-dynamicview-dynamicview3-example.html
/usr/share/doc/qt/qtquick/qtquick-tutorials-dynamicview-dynamicview4-example.html
/usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame1-example.html
/usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame2-example.html
/usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame3-example.html
/usr/share/doc/qt/qtquick/qtquick-tutorials-samegame-samegame4-example.html
/usr/share/doc/qt/qtquick/qtquick-views-example.html
/usr/share/doc/qt/qtquick/qtquick-visualcanvas-adaptations-d3d12.html
/usr/share/doc/qt/qtquick/qtquick-visualcanvas-adaptations-openvg.html
/usr/share/doc/qt/qtquick/qtquick-visualcanvas-adaptations-software.html
/usr/share/doc/qt/qtquick/qtquick-visualcanvas-adaptations.html
/usr/share/doc/qt/qtquick/qtquick-visualcanvas-coordinates.html
/usr/share/doc/qt/qtquick/qtquick-visualcanvas-scenegraph-renderer.html
/usr/share/doc/qt/qtquick/qtquick-visualcanvas-scenegraph.html
/usr/share/doc/qt/qtquick/qtquick-visualcanvas-topic.html
/usr/share/doc/qt/qtquick/qtquick-visualcanvas-visualparent.html
/usr/share/doc/qt/qtquick/qtquick-visualtypes-topic.html
/usr/share/doc/qt/qtquick/qtquick-window-example.html
/usr/share/doc/qt/qtquick/qtquick-window-qmlmodule.html
/usr/share/doc/qt/qtquick/qtquick.index
/usr/share/doc/qt/qtquick/qtquick.qhp
/usr/share/doc/qt/qtquick/qtquick.qhp.sha1
/usr/share/doc/qt/qtquick/qtquick.tags
/usr/share/doc/qt/qtquick/qtquickhandlers-index.html
/usr/share/doc/qt/qtquick/qtquicklayouts-index.html
/usr/share/doc/qt/qtquick/qtquicklayouts-overview.html
/usr/share/doc/qt/qtquick/qtquickwidgets-module.html
/usr/share/doc/qt/qtquick/images/3d-rotation-axis.png
/usr/share/doc/qt/qtquick/images/9BcAYDlpuT8.jpg
/usr/share/doc/qt/qtquick/images/ListViewHorizontal.png
/usr/share/doc/qt/qtquick/images/anchor_ordering.png
/usr/share/doc/qt/qtquick/images/anchor_ordering_bad.png
/usr/share/doc/qt/qtquick/images/anchorchanges.png
/usr/share/doc/qt/qtquick/images/animatedimageitem.gif
/usr/share/doc/qt/qtquick/images/animatedsprite-loading-frames.png
/usr/share/doc/qt/qtquick/images/animatedsprite-loading-interpolated.gif
/usr/share/doc/qt/qtquick/images/animatedsprite-loading.gif
/usr/share/doc/qt/qtquick/images/animatedsprite-loading.png
/usr/share/doc/qt/qtquick/images/arrow_bc.png
/usr/share/doc/qt/qtquick/images/axisrotation.png
/usr/share/doc/qt/qtquick/images/bgrContent.png
/usr/share/doc/qt/qtquick/images/btn_next.png
/usr/share/doc/qt/qtquick/images/btn_prev.png
/usr/share/doc/qt/qtquick/images/bullet_dn.png
/usr/share/doc/qt/qtquick/images/bullet_sq.png
/usr/share/doc/qt/qtquick/images/columnlayout.png
/usr/share/doc/qt/qtquick/images/custom-geometry-example.png
/usr/share/doc/qt/qtquick/images/declarative-adv-tutorial1.png
/usr/share/doc/qt/qtquick/images/declarative-adv-tutorial2.png
/usr/share/doc/qt/qtquick/images/declarative-adv-tutorial3.png
/usr/share/doc/qt/qtquick/images/declarative-adv-tutorial4.gif
/usr/share/doc/qt/qtquick/images/declarative-anchors_example.png
/usr/share/doc/qt/qtquick/images/declarative-anchors_example2.png
/usr/share/doc/qt/qtquick/images/declarative-arcdirection.png
/usr/share/doc/qt/qtquick/images/declarative-arcradius.png
/usr/share/doc/qt/qtquick/images/declarative-arcrotation.png
/usr/share/doc/qt/qtquick/images/declarative-colors.png
/usr/share/doc/qt/qtquick/images/declarative-gridmesh.png
/usr/share/doc/qt/qtquick/images/declarative-item_opacity1.png
/usr/share/doc/qt/qtquick/images/declarative-item_opacity2.png
/usr/share/doc/qt/qtquick/images/declarative-item_stacking1.png
/usr/share/doc/qt/qtquick/images/declarative-item_stacking2.png
/usr/share/doc/qt/qtquick/images/declarative-item_stacking3.png
/usr/share/doc/qt/qtquick/images/declarative-item_stacking4.png
/usr/share/doc/qt/qtquick/images/declarative-largearc.png
/usr/share/doc/qt/qtquick/images/declarative-nopercent.png
/usr/share/doc/qt/qtquick/images/declarative-patharc.png
/usr/share/doc/qt/qtquick/images/declarative-pathattribute.png
/usr/share/doc/qt/qtquick/images/declarative-pathcubic.png
/usr/share/doc/qt/qtquick/images/declarative-pathcurve.png
/usr/share/doc/qt/qtquick/images/declarative-pathquad.png
/usr/share/doc/qt/qtquick/images/declarative-pathsvg.png
/usr/share/doc/qt/qtquick/images/declarative-percent.png
/usr/share/doc/qt/qtquick/images/declarative-qmlfocus1.png
/usr/share/doc/qt/qtquick/images/declarative-qmlfocus2.png
/usr/share/doc/qt/qtquick/images/declarative-qmlfocus3.png
/usr/share/doc/qt/qtquick/images/declarative-qmlfocus4.png
/usr/share/doc/qt/qtquick/images/declarative-qmlfocus5.png
/usr/share/doc/qt/qtquick/images/declarative-qtlogo-preserveaspectcrop.png
/usr/share/doc/qt/qtquick/images/declarative-qtlogo-preserveaspectfit.png
/usr/share/doc/qt/qtquick/images/declarative-qtlogo-stretch.png
/usr/share/doc/qt/qtquick/images/declarative-qtlogo-tile.png
/usr/share/doc/qt/qtquick/images/declarative-qtlogo-tilehorizontally.png
/usr/share/doc/qt/qtquick/images/declarative-qtlogo-tilevertically.png
/usr/share/doc/qt/qtquick/images/declarative-qtlogo.png
/usr/share/doc/qt/qtquick/images/declarative-rect.png
/usr/share/doc/qt/qtquick/images/declarative-rect_gradient.png
/usr/share/doc/qt/qtquick/images/declarative-rotation.png
/usr/share/doc/qt/qtquick/images/declarative-samegame.png
/usr/share/doc/qt/qtquick/images/declarative-scale.png
/usr/share/doc/qt/qtquick/images/declarative-scalegrid.png
/usr/share/doc/qt/qtquick/images/declarative-shadereffectitem.png
/usr/share/doc/qt/qtquick/images/declarative-shadereffectsource.png
/usr/share/doc/qt/qtquick/images/declarative-text.png
/usr/share/doc/qt/qtquick/images/declarative-textballoons_example.png
/usr/share/doc/qt/qtquick/images/declarative-textedit.gif
/usr/share/doc/qt/qtquick/images/declarative-textformat.png
/usr/share/doc/qt/qtquick/images/declarative-textstyle.png
/usr/share/doc/qt/qtquick/images/declarative-transformorigin.png
/usr/share/doc/qt/qtquick/images/declarative-tutorial1.png
/usr/share/doc/qt/qtquick/images/declarative-tutorial2.png
/usr/share/doc/qt/qtquick/images/declarative-tutorial3_animation.gif
/usr/share/doc/qt/qtquick/images/edge1.png
/usr/share/doc/qt/qtquick/images/edge2.png
/usr/share/doc/qt/qtquick/images/edge3.png
/usr/share/doc/qt/qtquick/images/edge4.png
/usr/share/doc/qt/qtquick/images/edges_qml.png
/usr/share/doc/qt/qtquick/images/flickable-contentXY-bottom-left.png
/usr/share/doc/qt/qtquick/images/flickable-contentXY-bottom-right.png
/usr/share/doc/qt/qtquick/images/flickable-contentXY-resting.png
/usr/share/doc/qt/qtquick/images/flickable-contentXY-top-left.png
/usr/share/doc/qt/qtquick/images/flickable-contentXY-top-right.png
/usr/share/doc/qt/qtquick/images/flickable-rebound.gif
/usr/share/doc/qt/qtquick/images/flickable.gif
/usr/share/doc/qt/qtquick/images/flipable.gif
/usr/share/doc/qt/qtquick/images/fuzzydot.png
/usr/share/doc/qt/qtquick/images/gameoflife.png
/usr/share/doc/qt/qtquick/images/glowdot.png
/usr/share/doc/qt/qtquick/images/graph-example.jpg
/usr/share/doc/qt/qtquick/images/gridLayout_aligncenter.png
/usr/share/doc/qt/qtquick/images/gridLayout_aligntop.png
/usr/share/doc/qt/qtquick/images/gridLayout_aligntopleft.png
/usr/share/doc/qt/qtquick/images/gridLayout_example.png
/usr/share/doc/qt/qtquick/images/gridlayout.png
/usr/share/doc/qt/qtquick/images/gridview-highlight.png
/usr/share/doc/qt/qtquick/images/gridview-layout-lefttoright-ltr-btt.png
/usr/share/doc/qt/qtquick/images/gridview-layout-lefttoright-ltr-ttb.png
/usr/share/doc/qt/qtquick/images/gridview-layout-lefttoright-rtl-btt.png
/usr/share/doc/qt/qtquick/images/gridview-layout-lefttoright-rtl-ttb.png
/usr/share/doc/qt/qtquick/images/gridview-layout-toptobottom-ltr-btt.png
/usr/share/doc/qt/qtquick/images/gridview-layout-toptobottom-ltr-ttb.png
/usr/share/doc/qt/qtquick/images/gridview-layout-toptobottom-rtl-btt.png
/usr/share/doc/qt/qtquick/images/gridview-layout-toptobottom-rtl-ttb.png
/usr/share/doc/qt/qtquick/images/gridview-simple.png
/usr/share/doc/qt/qtquick/images/home.png
/usr/share/doc/qt/qtquick/images/horizontalpositioner_example.png
/usr/share/doc/qt/qtquick/images/ico_note.png
/usr/share/doc/qt/qtquick/images/ico_note_attention.png
/usr/share/doc/qt/qtquick/images/ico_out.png
/usr/share/doc/qt/qtquick/images/imageprovider.png
/usr/share/doc/qt/qtquick/images/layoutmirroring.png
/usr/share/doc/qt/qtquick/images/listview-decorations.png
/usr/share/doc/qt/qtquick/images/listview-highlight.png
/usr/share/doc/qt/qtquick/images/listview-layout-bottomtotop.png
/usr/share/doc/qt/qtquick/images/listview-layout-lefttoright.png
/usr/share/doc/qt/qtquick/images/listview-layout-righttoleft.png
/usr/share/doc/qt/qtquick/images/listview-layout-toptobottom.png
/usr/share/doc/qt/qtquick/images/listview-section.png
/usr/share/doc/qt/qtquick/images/listview-setup.png
/usr/share/doc/qt/qtquick/images/listview-simple.png
/usr/share/doc/qt/qtquick/images/logo.png
/usr/share/doc/qt/qtquick/images/manual-layout.png
/usr/share/doc/qt/qtquick/images/margins_qml.png
/usr/share/doc/qt/qtquick/images/modelview-overview.png
/usr/share/doc/qt/qtquick/images/openglunderqml-example.jpg
/usr/share/doc/qt/qtquick/images/parentchange.png
/usr/share/doc/qt/qtquick/images/pathitem-code-example.png
/usr/share/doc/qt/qtquick/images/pathview.gif
/usr/share/doc/qt/qtquick/images/pointerHandlerMargin.png
/usr/share/doc/qt/qtquick/images/positioner-example.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-inback.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-inbounce.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-incirc.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-incubic.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-inelastic.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-inexpo.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-inoutback.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-inoutbounce.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-inoutcirc.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-inoutcubic.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-inoutelastic.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-inoutexpo.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-inoutquad.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-inoutquart.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-inoutquint.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-inoutsine.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-inquad.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-inquart.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-inquint.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-insine.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-linear.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-outback.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-outbounce.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-outcirc.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-outcubic.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-outelastic.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-outexpo.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-outinback.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-outinbounce.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-outincirc.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-outincubic.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-outinelastic.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-outinexpo.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-outinquad.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-outinquart.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-outinquint.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-outinsine.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-outquad.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-outquart.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-outquint.png
/usr/share/doc/qt/qtquick/images/qeasingcurve-outsine.png
/usr/share/doc/qt/qtquick/images/qml-abstractitemmodel-example.png
/usr/share/doc/qt/qtquick/images/qml-affectors-example.png
/usr/share/doc/qt/qtquick/images/qml-animations-example.png
/usr/share/doc/qt/qtquick/images/qml-blending-layered.png
/usr/share/doc/qt/qtquick/images/qml-blending-nonlayered.png
/usr/share/doc/qt/qtquick/images/qml-borderimage-normal-image.png
/usr/share/doc/qt/qtquick/images/qml-borderimage-scaled.png
/usr/share/doc/qt/qtquick/images/qml-borderimage-tiled.png
/usr/share/doc/qt/qtquick/images/qml-canvas-example.png
/usr/share/doc/qt/qtquick/images/qml-column.png
/usr/share/doc/qt/qtquick/images/qml-customparticle-example.png
/usr/share/doc/qt/qtquick/images/qml-dialcontrol-example.png
/usr/share/doc/qt/qtquick/images/qml-dnd2-example.png
/usr/share/doc/qt/qtquick/images/qml-draganddrop-example.png
/usr/share/doc/qt/qtquick/images/qml-emitters-example.png
/usr/share/doc/qt/qtquick/images/qml-flipable-example.png
/usr/share/doc/qt/qtquick/images/qml-flow-snippet.png
/usr/share/doc/qt/qtquick/images/qml-flow-text1.png
/usr/share/doc/qt/qtquick/images/qml-flow-text2.png
/usr/share/doc/qt/qtquick/images/qml-gradient.png
/usr/share/doc/qt/qtquick/images/qml-grid-no-spacing.png
/usr/share/doc/qt/qtquick/images/qml-grid-spacing.png
/usr/share/doc/qt/qtquick/images/qml-imageelements-example.png
/usr/share/doc/qt/qtquick/images/qml-imageparticle-example.png
/usr/share/doc/qt/qtquick/images/qml-imageprovider-example.png
/usr/share/doc/qt/qtquick/images/qml-item-canvas-arc.png
/usr/share/doc/qt/qtquick/images/qml-item-canvas-arcTo.png
/usr/share/doc/qt/qtquick/images/qml-item-canvas-bezierCurveTo.png
/usr/share/doc/qt/qtquick/images/qml-item-canvas-clip-complex.png
/usr/share/doc/qt/qtquick/images/qml-item-canvas-context.gif
/usr/share/doc/qt/qtquick/images/qml-item-canvas-lineDash.png
/usr/share/doc/qt/qtquick/images/qml-item-canvas-math-rotate.png
/usr/share/doc/qt/qtquick/images/qml-item-canvas-math.png
/usr/share/doc/qt/qtquick/images/qml-item-canvas-rotate.png
/usr/share/doc/qt/qtquick/images/qml-item-canvas-scale.png
/usr/share/doc/qt/qtquick/images/qml-item-canvas-scalex.png
/usr/share/doc/qt/qtquick/images/qml-item-canvas-scaley.png
/usr/share/doc/qt/qtquick/images/qml-item-canvas-skewx.png
/usr/share/doc/qt/qtquick/images/qml-item-canvas-skewy.png
/usr/share/doc/qt/qtquick/images/qml-item-canvas-startAngle.png
/usr/share/doc/qt/qtquick/images/qml-item-canvas-translate.png
/usr/share/doc/qt/qtquick/images/qml-item-canvas-translatey.png
/usr/share/doc/qt/qtquick/images/qml-keyinteraction-example.png
/usr/share/doc/qt/qtquick/images/qml-listview-sections-example.png
/usr/share/doc/qt/qtquick/images/qml-localstorage-example.png
/usr/share/doc/qt/qtquick/images/qml-modelviews-example.png
/usr/share/doc/qt/qtquick/images/qml-mousearea-example.png
/usr/share/doc/qt/qtquick/images/qml-mousearea-snippet.png
/usr/share/doc/qt/qtquick/images/qml-objectlistmodel-example.png
/usr/share/doc/qt/qtquick/images/qml-positioners-example.png
/usr/share/doc/qt/qtquick/images/qml-righttoleft-example.png
/usr/share/doc/qt/qtquick/images/qml-row.png
/usr/share/doc/qt/qtquick/images/qml-scrollbar-example.png
/usr/share/doc/qt/qtquick/images/qml-shadereffect-layereffect.png
/usr/share/doc/qt/qtquick/images/qml-shadereffect-nolayereffect.png
/usr/share/doc/qt/qtquick/images/qml-shadereffect-opacitymask.png
/usr/share/doc/qt/qtquick/images/qml-shadereffects-example.png
/usr/share/doc/qt/qtquick/images/qml-shapes-example.png
/usr/share/doc/qt/qtquick/images/qml-stringlistmodel-example.png
/usr/share/doc/qt/qtquick/images/qml-system-example.png
/usr/share/doc/qt/qtquick/images/qml-tabwidget-example.png
/usr/share/doc/qt/qtquick/images/qml-text-example.png
/usr/share/doc/qt/qtquick/images/qml-threading-example.png
/usr/share/doc/qt/qtquick/images/qml-touchinteraction-example.png
/usr/share/doc/qt/qtquick/images/qml-window-example.png
/usr/share/doc/qt/qtquick/images/qt-pixelator.png
/usr/share/doc/qt/qtquick/images/qtlabs-wavefrontmesh.png
/usr/share/doc/qt/qtquick/images/qtquickcontrols2-gallery-welcome.png
/usr/share/doc/qt/qtquick/images/qtquicklayouts-example-layouts.png
/usr/share/doc/qt/qtquick/images/qtquickwidgets-example.png
/usr/share/doc/qt/qtquick/images/rect-color.png
/usr/share/doc/qt/qtquick/images/rendercontrol-example.jpg
/usr/share/doc/qt/qtquick/images/repeater-index.png
/usr/share/doc/qt/qtquick/images/repeater-modeldata.png
/usr/share/doc/qt/qtquick/images/repeater-simple.png
/usr/share/doc/qt/qtquick/images/repeater.png
/usr/share/doc/qt/qtquick/images/rowlayout-minimum.png
/usr/share/doc/qt/qtquick/images/rowlayout.png
/usr/share/doc/qt/qtquick/images/screen-and-window-dimensions.jpg
/usr/share/doc/qt/qtquick/images/sg-renderloop-singlethreaded.png
/usr/share/doc/qt/qtquick/images/sg-renderloop-threaded.png
/usr/share/doc/qt/qtquick/images/shape-radial-gradient.png
/usr/share/doc/qt/qtquick/images/simplematerial-example.jpg
/usr/share/doc/qt/qtquick/images/spritecutting.png
/usr/share/doc/qt/qtquick/images/spriteenginegraph.png
/usr/share/doc/qt/qtquick/images/star.png
/usr/share/doc/qt/qtquick/images/textureinsgnode-example.jpg
/usr/share/doc/qt/qtquick/images/textureinthread-example.jpg
/usr/share/doc/qt/qtquick/images/touchpoint-metrics.png
/usr/share/doc/qt/qtquick/images/touchpoints-pinchhandler.png
/usr/share/doc/qt/qtquick/images/translate.png
/usr/share/doc/qt/qtquick/images/twotextureproviders-example.jpg
/usr/share/doc/qt/qtquick/images/verticalpositioner_example.png
/usr/share/doc/qt/qtquick/images/verticalpositioner_transition.gif
/usr/share/doc/qt/qtquick/images/viewtransitions-basic.gif
/usr/share/doc/qt/qtquick/images/viewtransitions-delayedbyindex.gif
/usr/share/doc/qt/qtquick/images/viewtransitions-intermediatemove.gif
/usr/share/doc/qt/qtquick/images/viewtransitions-interruptedbad.gif
/usr/share/doc/qt/qtquick/images/viewtransitions-interruptedgood.gif
/usr/share/doc/qt/qtquick/images/viewtransitions-pathanim.gif
/usr/share/doc/qt/qtquick/images/viewtransitions-scriptactionbad.gif
/usr/share/doc/qt/qtquick/images/visual-coordinates-example.png
/usr/share/doc/qt/qtquick/images/visual-parent-example.png
/usr/share/doc/qt/qtquick/images/visual-parent-example2.png
/usr/share/doc/qt/qtquick/images/visualcanvas_list.png
/usr/share/doc/qt/qtquick/images/visualcanvas_overlap.png
/usr/share/doc/qt/qtquick/images/visualize-batches.png
/usr/share/doc/qt/qtquick/images/visualize-clip.png
/usr/share/doc/qt/qtquick/images/visualize-original.png
/usr/share/doc/qt/qtquick/images/visualize-overdraw-1.png
/usr/share/doc/qt/qtquick/images/visualize-overdraw-2.png
/usr/share/doc/qt/qtquick/images/visualpath-code-example.png
/usr/share/doc/qt/qtquick/style/offline-simple.css
/usr/share/doc/qt/qtquick/style/offline.css
/usr/share/doc/qt/qtquickcontrols/examples-manifest.xml
/usr/share/doc/qt/qtquickcontrols/qml-palette.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-abstractbutton-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-abstractbutton.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-action-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-action.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-actiongroup-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-actiongroup.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-applicationwindow-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-applicationwindow-obsolete.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-applicationwindow.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-busyindicator-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-busyindicator.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-button-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-button.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-buttongroup-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-buttongroup.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-checkbox-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-checkbox.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-checkdelegate-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-checkdelegate.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-combobox-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-combobox.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-container-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-container-obsolete.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-container.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-control-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-control.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-delaybutton-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-delaybutton.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-dial-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-dial.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-dialog-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-dialog.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-dialogbuttonbox-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-dialogbuttonbox.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-drawer-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-drawer.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-frame-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-frame.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-groupbox-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-groupbox.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-itemdelegate-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-itemdelegate.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-label-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-label.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-menu-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-menu-obsolete.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-menu.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-menubar-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-menubar.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-menubaritem-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-menubaritem.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-menuitem-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-menuitem.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-menuseparator-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-menuseparator.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-overlay-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-overlay.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-page-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-page.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-pageindicator-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-pageindicator.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-pane-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-pane.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-popup-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-popup.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-progressbar-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-progressbar.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-radiobutton-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-radiobutton.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-radiodelegate-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-radiodelegate.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-rangeslider-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-rangeslider.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-roundbutton-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-roundbutton.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-scrollbar-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-scrollbar.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-scrollindicator-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-scrollindicator.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-scrollview-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-scrollview.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-slider-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-slider.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-spinbox-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-spinbox.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-splithandle-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-splithandle.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-splitview-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-splitview.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-stackview-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-stackview.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-swipedelegate-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-swipedelegate.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-swipeview-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-swipeview.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-switch-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-switch.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-switchdelegate-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-switchdelegate.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-tabbar-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-tabbar.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-tabbutton-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-tabbutton.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-textarea-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-textarea.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-textfield-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-textfield.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-toolbar-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-toolbar.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-toolbutton-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-toolbutton.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-toolseparator-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-toolseparator.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-tooltip-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-tooltip.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-tumbler-members.html
/usr/share/doc/qt/qtquickcontrols/qml-qtquick-controls2-tumbler.html
/usr/share/doc/qt/qtquickcontrols/qquickstyle-members.html
/usr/share/doc/qt/qtquickcontrols/qquickstyle.html
/usr/share/doc/qt/qtquickcontrols/qtquick-controls2-qmlmodule.html
/usr/share/doc/qt/qtquickcontrols/qtquick-templates2-qmlmodule.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols-attribution-shadow-angular-material.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols-chattutorial-example.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols-contactlist-example.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols-flatstyle-example.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols-gallery-example.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols-imagine-automotive-example.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols-imagine-musicplayer-example.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols-index.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols-sidepanel-example.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols-swipetoremove-example.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols-texteditor-example.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols-wearable-example.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols.index
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols.qhp
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols.qhp.sha1
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols.tags
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-buttons.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-configuration.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-containers.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-customize.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-default.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-delegates.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-deployment.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-differences.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-environment.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-examples.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-fileselectors.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-focus.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-fusion.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-gettingstarted.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-guidelines.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-highdpi.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-icons.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-imagine.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-indicators.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-input.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-material.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-menus.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-module.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-navigation.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-popups.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-separators.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-styles.html
/usr/share/doc/qt/qtquickcontrols/qtquickcontrols2-universal.html
/usr/share/doc/qt/qtquickcontrols/qtquicktemplates2-index.html
/usr/share/doc/qt/qtquickcontrols/images/applicationwindow-background.png
/usr/share/doc/qt/qtquickcontrols/images/applicationwindow-overlay-modal.png
/usr/share/doc/qt/qtquickcontrols/images/applicationwindow-overlay.png
/usr/share/doc/qt/qtquickcontrols/images/arrow_bc.png
/usr/share/doc/qt/qtquickcontrols/images/bgrContent.png
/usr/share/doc/qt/qtquickcontrols/images/btn_next.png
/usr/share/doc/qt/qtquickcontrols/images/btn_prev.png
/usr/share/doc/qt/qtquickcontrols/images/bullet_dn.png
/usr/share/doc/qt/qtquickcontrols/images/bullet_sq.png
/usr/share/doc/qt/qtquickcontrols/images/button-background-checked-disabled.9.png
/usr/share/doc/qt/qtquickcontrols/images/button-background-checked-focused.9.png
/usr/share/doc/qt/qtquickcontrols/images/button-background-checked-hovered.9.png
/usr/share/doc/qt/qtquickcontrols/images/button-background-checked.9.png
/usr/share/doc/qt/qtquickcontrols/images/button-background-disabled.9.png
/usr/share/doc/qt/qtquickcontrols/images/button-background-flat-checked.9.png
/usr/share/doc/qt/qtquickcontrols/images/button-background-flat-disabled.9.png
/usr/share/doc/qt/qtquickcontrols/images/button-background-flat-hovered.9.png
/usr/share/doc/qt/qtquickcontrols/images/button-background-flat-pressed.9.png
/usr/share/doc/qt/qtquickcontrols/images/button-background-flat.9.png
/usr/share/doc/qt/qtquickcontrols/images/button-background-focused.9.png
/usr/share/doc/qt/qtquickcontrols/images/button-background-highlighted-checked.9.png
/usr/share/doc/qt/qtquickcontrols/images/button-background-highlighted-disabled.9.png
/usr/share/doc/qt/qtquickcontrols/images/button-background-highlighted-focused.9.png
/usr/share/doc/qt/qtquickcontrols/images/button-background-highlighted-hovered.9.png
/usr/share/doc/qt/qtquickcontrols/images/button-background-highlighted-pressed.9.png
/usr/share/doc/qt/qtquickcontrols/images/button-background-highlighted.9.png
/usr/share/doc/qt/qtquickcontrols/images/button-background-hovered.9.png
/usr/share/doc/qt/qtquickcontrols/images/button-background-pressed.9.png
/usr/share/doc/qt/qtquickcontrols/images/button-background.9.png
/usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator-checked-focused.png
/usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator-checked-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator-checked-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator-checked.png
/usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator-disabled.png
/usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator-focused.png
/usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator-partially-checked-focused.png
/usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator-partially-checked-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator-partially-checked-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator-partially-checked.png
/usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/checkbox-indicator.png
/usr/share/doc/qt/qtquickcontrols/images/checkdelegate-background-disabled.9.png
/usr/share/doc/qt/qtquickcontrols/images/checkdelegate-background-focused.9.png
/usr/share/doc/qt/qtquickcontrols/images/checkdelegate-background-hovered.9.png
/usr/share/doc/qt/qtquickcontrols/images/checkdelegate-background-pressed.9.png
/usr/share/doc/qt/qtquickcontrols/images/checkdelegate-background.9.png
/usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator-checked-focused.png
/usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator-checked-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator-checked-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator-checked.png
/usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator-disabled.png
/usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator-focused.png
/usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator-partially-checked-focused.png
/usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator-partially-checked-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator-partially-checked-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator-partially-checked.png
/usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/checkdelegate-indicator.png
/usr/share/doc/qt/qtquickcontrols/images/combobox-background-disabled.9.png
/usr/share/doc/qt/qtquickcontrols/images/combobox-background-editable-disabled.9.png
/usr/share/doc/qt/qtquickcontrols/images/combobox-background-editable-focused.9.png
/usr/share/doc/qt/qtquickcontrols/images/combobox-background-editable.9.png
/usr/share/doc/qt/qtquickcontrols/images/combobox-background-focused.9.png
/usr/share/doc/qt/qtquickcontrols/images/combobox-background-hovered.9.png
/usr/share/doc/qt/qtquickcontrols/images/combobox-background-open.9.png
/usr/share/doc/qt/qtquickcontrols/images/combobox-background-pressed.9.png
/usr/share/doc/qt/qtquickcontrols/images/combobox-background.9.png
/usr/share/doc/qt/qtquickcontrols/images/combobox-indicator-disabled.png
/usr/share/doc/qt/qtquickcontrols/images/combobox-indicator-editable-disabled.png
/usr/share/doc/qt/qtquickcontrols/images/combobox-indicator-editable-mirrored-disabled.png
/usr/share/doc/qt/qtquickcontrols/images/combobox-indicator-editable-mirrored.png
/usr/share/doc/qt/qtquickcontrols/images/combobox-indicator-editable.png
/usr/share/doc/qt/qtquickcontrols/images/combobox-indicator.png
/usr/share/doc/qt/qtquickcontrols/images/combobox-popup.9.png
/usr/share/doc/qt/qtquickcontrols/images/delaybutton-background-checked-focused.9.png
/usr/share/doc/qt/qtquickcontrols/images/delaybutton-background-checked-hovered.9.png
/usr/share/doc/qt/qtquickcontrols/images/delaybutton-background-checked.9.png
/usr/share/doc/qt/qtquickcontrols/images/delaybutton-background-disabled-checked.9.png
/usr/share/doc/qt/qtquickcontrols/images/delaybutton-background-disabled.9.png
/usr/share/doc/qt/qtquickcontrols/images/delaybutton-background-focused.9.png
/usr/share/doc/qt/qtquickcontrols/images/delaybutton-background-hovered.9.png
/usr/share/doc/qt/qtquickcontrols/images/delaybutton-background-pressed.9.png
/usr/share/doc/qt/qtquickcontrols/images/delaybutton-background.9.png
/usr/share/doc/qt/qtquickcontrols/images/delaybutton-mask.9.png
/usr/share/doc/qt/qtquickcontrols/images/delaybutton-progress-disabled.9.png
/usr/share/doc/qt/qtquickcontrols/images/delaybutton-progress.9.png
/usr/share/doc/qt/qtquickcontrols/images/dial-background-disabled.png
/usr/share/doc/qt/qtquickcontrols/images/dial-background-focused.png
/usr/share/doc/qt/qtquickcontrols/images/dial-background.png
/usr/share/doc/qt/qtquickcontrols/images/dial-handle-disabled.png
/usr/share/doc/qt/qtquickcontrols/images/dial-handle-focused-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/dial-handle-focused-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/dial-handle-focused.png
/usr/share/doc/qt/qtquickcontrols/images/dial-handle-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/dial-handle-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/dial-handle.png
/usr/share/doc/qt/qtquickcontrols/images/dialog-background.9.png
/usr/share/doc/qt/qtquickcontrols/images/dialog-overlay-modal.png
/usr/share/doc/qt/qtquickcontrols/images/dialog-overlay.png
/usr/share/doc/qt/qtquickcontrols/images/dialogbuttonbox-background.9.png
/usr/share/doc/qt/qtquickcontrols/images/drawer-background-bottom.9.png
/usr/share/doc/qt/qtquickcontrols/images/drawer-background-left.9.png
/usr/share/doc/qt/qtquickcontrols/images/drawer-background-right.9.png
/usr/share/doc/qt/qtquickcontrols/images/drawer-background-top.9.png
/usr/share/doc/qt/qtquickcontrols/images/drawer-overlay-modal.png
/usr/share/doc/qt/qtquickcontrols/images/drawer-overlay.png
/usr/share/doc/qt/qtquickcontrols/images/frame-background.9.png
/usr/share/doc/qt/qtquickcontrols/images/groupbox-background.9.png
/usr/share/doc/qt/qtquickcontrols/images/groupbox-title.9.png
/usr/share/doc/qt/qtquickcontrols/images/home.png
/usr/share/doc/qt/qtquickcontrols/images/ico_note.png
/usr/share/doc/qt/qtquickcontrols/images/ico_note_attention.png
/usr/share/doc/qt/qtquickcontrols/images/ico_out.png
/usr/share/doc/qt/qtquickcontrols/images/itemdelegate-background-disabled.9.png
/usr/share/doc/qt/qtquickcontrols/images/itemdelegate-background-focused.9.png
/usr/share/doc/qt/qtquickcontrols/images/itemdelegate-background-highlighted.9.png
/usr/share/doc/qt/qtquickcontrols/images/itemdelegate-background-hovered.9.png
/usr/share/doc/qt/qtquickcontrols/images/itemdelegate-background-pressed.9.png
/usr/share/doc/qt/qtquickcontrols/images/itemdelegate-background.9.png
/usr/share/doc/qt/qtquickcontrols/images/logo.png
/usr/share/doc/qt/qtquickcontrols/images/menu-background.9.png
/usr/share/doc/qt/qtquickcontrols/images/menuitem-arrow-disabled.png
/usr/share/doc/qt/qtquickcontrols/images/menuitem-arrow-mirrored-disabled.png
/usr/share/doc/qt/qtquickcontrols/images/menuitem-arrow-mirrored.png
/usr/share/doc/qt/qtquickcontrols/images/menuitem-arrow.png
/usr/share/doc/qt/qtquickcontrols/images/menuitem-background-highlighted.9.png
/usr/share/doc/qt/qtquickcontrols/images/menuitem-background.9.png
/usr/share/doc/qt/qtquickcontrols/images/menuitem-indicator-checked-focused.png
/usr/share/doc/qt/qtquickcontrols/images/menuitem-indicator-checked-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/menuitem-indicator-checked-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/menuitem-indicator-checked.png
/usr/share/doc/qt/qtquickcontrols/images/menuitem-indicator-disabled.png
/usr/share/doc/qt/qtquickcontrols/images/menuitem-indicator-focused.png
/usr/share/doc/qt/qtquickcontrols/images/menuitem-indicator-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/menuitem-indicator-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/menuitem-indicator.png
/usr/share/doc/qt/qtquickcontrols/images/menuseparator-separator.9.png
/usr/share/doc/qt/qtquickcontrols/images/page-background.png
/usr/share/doc/qt/qtquickcontrols/images/pageindicator-delegate-current.png
/usr/share/doc/qt/qtquickcontrols/images/pageindicator-delegate-disabled-current.png
/usr/share/doc/qt/qtquickcontrols/images/pageindicator-delegate-disabled.png
/usr/share/doc/qt/qtquickcontrols/images/pageindicator-delegate-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/pageindicator-delegate.png
/usr/share/doc/qt/qtquickcontrols/images/pane-background.9.png
/usr/share/doc/qt/qtquickcontrols/images/popup-background.9.png
/usr/share/doc/qt/qtquickcontrols/images/popup-overlay-modal.png
/usr/share/doc/qt/qtquickcontrols/images/popup-overlay.png
/usr/share/doc/qt/qtquickcontrols/images/progressbar-background.9.png
/usr/share/doc/qt/qtquickcontrols/images/progressbar-mask.9.png
/usr/share/doc/qt/qtquickcontrols/images/progressbar-progress.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-applicationwindow-wireframe.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-automotive.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-busyindicator-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-busyindicator.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-busyindicator.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-button-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-button-flat.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-button-highlighted.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-button-icononly.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-button-textbesideicon.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-button-textonly.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-button-textundericon.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-button.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter1.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter2-listview-header.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter2.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter3-listview-header.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter3-view-margins.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter3.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter4-long-message.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter4-message-timestamp.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter4.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-contacts-material-dark.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-contacts-material-test.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-contacts-material.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-contacts-universal-dark.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-contacts-universal.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-conversations-material-dark.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-conversations-material-test.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-conversations-material.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-conversations-universal-dark.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-chattutorial-chapter5-conversations-universal.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-checkbox-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-checkbox-group.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-checkbox-tristate.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-checkbox.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-checkdelegate-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-checkdelegate-tristate.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-checkdelegate.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-combobox-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-combobox.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-contactlist.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-control.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-customize-buttons.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-default-thumbnail.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-default.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-delaybutton-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-delaybutton.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-dial-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-dial-inputmode.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-dial-no-wrap.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-dial-wrap.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-dial.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-dialogbuttonbox.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-drawer-expanded-wireframe.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-drawer.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-flatstyle-creator.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-flatstyle.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-frame-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-frame.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-fusion-palettes.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-fusion-thumbnail.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-fusion-violet.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-fusion.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-gallery-drawer.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-gallery-menu.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-gallery-welcome.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-groupbox-checkable.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-groupbox-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-groupbox.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-imagine-9-patch-4x.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-imagine-9-patch-inset-boundaries.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-imagine-9-patch-inset.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-imagine-9-patch-resized-padding.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-imagine-9-patch-resized-stretchable.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-imagine-9-patch-size.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-imagine-customization-dark.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-imagine-thumbnail.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-imagine.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-itemdelegate-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-itemdelegate.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-label-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-label.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-material-accent.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-material-attributes.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-material-background.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-material-dark.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-material-elevation.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-material-foreground.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-material-light.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-material-purple.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-material-theme.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-material-thumbnail.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-material-variant-dense.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-material-variant-normal.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-menu-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-menu.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-menubar-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-menubar.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-menuseparator.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-musicplayer.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-page-wireframe.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-pageindicator-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-pageindicator.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-pane-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-pane.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-popup-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-popup-settings.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-popup-transformorigin.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-popup.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-progressbar-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-progressbar-indeterminate.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-progressbar.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-radiobutton-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-radiobutton.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-radiodelegate-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-radiodelegate.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-rangeslider-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-rangeslider.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-roundbutton.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-scrollbar-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-scrollbar-non-attached.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-scrollbar-nosnap.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-scrollbar-snapalways.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-scrollbar-snaponrelease.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-scrollbar.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-scrollindicator-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-scrollindicator-non-attached.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-scrollindicator.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-scrollview-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-scrollview-wireframe.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-scrollview.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-sidepanel-landscape.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-sidepanel-portrait.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-slider-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-slider-nosnap.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-slider-snapalways.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-slider-snaponrelease.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-slider.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-spinbox-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-spinbox-double.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-spinbox-textual.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-spinbox.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-splitview-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-stackview-pop.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-stackview-push.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-stackview-replace.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-stackview-unwind.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-stackview-visible.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-stackview-wireframe.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-styles.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-swipedelegate-behind.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-swipedelegate-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-swipedelegate-leading-trailing.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-swipedelegate.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-swipetoremove.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-swipeview-wireframe.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-swipeview.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-switch-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-switch.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-switch.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-switchdelegate-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-switchdelegate.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-tabbar-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-tabbar-explicit.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-tabbar-flickable.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-tabbar-wireframe.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-tabbutton.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-textarea-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-textarea-scrollable.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-textarea.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-texteditor-desktop.jpg
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-texteditor-touch.jpg
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-textfield-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-textfield-disabled.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-textfield-focused.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-textfield-normal.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-textfield.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-toolbar-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-toolbar.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-toolbutton-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-toolbutton.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-toolseparator-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-toolseparator.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-tooltip-slider.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-tooltip.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-tumbler-custom.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-tumbler-wrap.gif
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-tumbler.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-universal-accent.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-universal-attributes.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-universal-background.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-universal-dark.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-universal-foreground.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-universal-light.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-universal-theme.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-universal-thumbnail.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-universal-violet.png
/usr/share/doc/qt/qtquickcontrols/images/qtquickcontrols2-wearable.png
/usr/share/doc/qt/qtquickcontrols/images/radiobutton-indicator-checked-focused.png
/usr/share/doc/qt/qtquickcontrols/images/radiobutton-indicator-checked-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/radiobutton-indicator-checked-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/radiobutton-indicator-checked.png
/usr/share/doc/qt/qtquickcontrols/images/radiobutton-indicator-disabled.png
/usr/share/doc/qt/qtquickcontrols/images/radiobutton-indicator-focused.png
/usr/share/doc/qt/qtquickcontrols/images/radiobutton-indicator-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/radiobutton-indicator-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/radiobutton-indicator.png
/usr/share/doc/qt/qtquickcontrols/images/radiodelegate-background-disabled.9.png
/usr/share/doc/qt/qtquickcontrols/images/radiodelegate-background-focused.9.png
/usr/share/doc/qt/qtquickcontrols/images/radiodelegate-background-hovered.9.png
/usr/share/doc/qt/qtquickcontrols/images/radiodelegate-background-pressed.9.png
/usr/share/doc/qt/qtquickcontrols/images/radiodelegate-background.9.png
/usr/share/doc/qt/qtquickcontrols/images/radiodelegate-indicator-checked-focused.png
/usr/share/doc/qt/qtquickcontrols/images/radiodelegate-indicator-checked-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/radiodelegate-indicator-checked-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/radiodelegate-indicator-checked.png
/usr/share/doc/qt/qtquickcontrols/images/radiodelegate-indicator-disabled.png
/usr/share/doc/qt/qtquickcontrols/images/radiodelegate-indicator-focused.png
/usr/share/doc/qt/qtquickcontrols/images/radiodelegate-indicator-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/radiodelegate-indicator-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/radiodelegate-indicator.png
/usr/share/doc/qt/qtquickcontrols/images/rangeslider-background-horizontal.9.png
/usr/share/doc/qt/qtquickcontrols/images/rangeslider-background-vertical.9.png
/usr/share/doc/qt/qtquickcontrols/images/rangeslider-handle-disabled.png
/usr/share/doc/qt/qtquickcontrols/images/rangeslider-handle-focused-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/rangeslider-handle-focused-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/rangeslider-handle-focused.png
/usr/share/doc/qt/qtquickcontrols/images/rangeslider-handle-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/rangeslider-handle-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/rangeslider-handle.png
/usr/share/doc/qt/qtquickcontrols/images/rangeslider-progress-horizontal-disabled.9.png
/usr/share/doc/qt/qtquickcontrols/images/rangeslider-progress-horizontal.9.png
/usr/share/doc/qt/qtquickcontrols/images/rangeslider-progress-vertical-disabled.9.png
/usr/share/doc/qt/qtquickcontrols/images/rangeslider-progress-vertical.9.png
/usr/share/doc/qt/qtquickcontrols/images/roundbutton-background-checked-focused.png
/usr/share/doc/qt/qtquickcontrols/images/roundbutton-background-checked-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/roundbutton-background-checked.png
/usr/share/doc/qt/qtquickcontrols/images/roundbutton-background-disabled-checked.png
/usr/share/doc/qt/qtquickcontrols/images/roundbutton-background-disabled.png
/usr/share/doc/qt/qtquickcontrols/images/roundbutton-background-focused.png
/usr/share/doc/qt/qtquickcontrols/images/roundbutton-background-highlighted-focused.png
/usr/share/doc/qt/qtquickcontrols/images/roundbutton-background-highlighted-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/roundbutton-background-highlighted-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/roundbutton-background-highlighted.png
/usr/share/doc/qt/qtquickcontrols/images/roundbutton-background-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/roundbutton-background-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/roundbutton-background.png
/usr/share/doc/qt/qtquickcontrols/images/scrollbar-handle-disabled.png
/usr/share/doc/qt/qtquickcontrols/images/scrollbar-handle-interactive-disabled.png
/usr/share/doc/qt/qtquickcontrols/images/scrollbar-handle-interactive-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/scrollbar-handle-interactive-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/scrollbar-handle-interactive.png
/usr/share/doc/qt/qtquickcontrols/images/scrollbar-handle.png
/usr/share/doc/qt/qtquickcontrols/images/scrollindicator-handle.png
/usr/share/doc/qt/qtquickcontrols/images/slider-background-horizontal.9.png
/usr/share/doc/qt/qtquickcontrols/images/slider-background-vertical.9.png
/usr/share/doc/qt/qtquickcontrols/images/slider-handle-disabled.png
/usr/share/doc/qt/qtquickcontrols/images/slider-handle-focused-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/slider-handle-focused-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/slider-handle-focused.png
/usr/share/doc/qt/qtquickcontrols/images/slider-handle-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/slider-handle-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/slider-handle.png
/usr/share/doc/qt/qtquickcontrols/images/slider-progress-horizontal-disabled.9.png
/usr/share/doc/qt/qtquickcontrols/images/slider-progress-horizontal.9.png
/usr/share/doc/qt/qtquickcontrols/images/slider-progress-vertical-disabled.9.png
/usr/share/doc/qt/qtquickcontrols/images/slider-progress-vertical.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-background-disabled.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-background-editable.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-background-focused.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-background.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-down-disabled.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-down-editable-focused.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-down-editable-hovered.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-down-editable-mirrored.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-down-editable-pressed.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-down-editable.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-down-focused.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-down-hovered.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-down-mirrored.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-down-pressed.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-down.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-up-disabled.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-up-editable-focused.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-up-editable-hovered.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-up-editable-mirrored.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-up-editable-pressed.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-up-editable.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-up-focused.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-up-hovered.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-up-mirrored.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-up-pressed.9.png
/usr/share/doc/qt/qtquickcontrols/images/spinbox-indicator-up.9.png
/usr/share/doc/qt/qtquickcontrols/images/swipedelegate-background-disabled.9.png
/usr/share/doc/qt/qtquickcontrols/images/swipedelegate-background-focused.9.png
/usr/share/doc/qt/qtquickcontrols/images/swipedelegate-background-hovered.9.png
/usr/share/doc/qt/qtquickcontrols/images/swipedelegate-background-pressed.9.png
/usr/share/doc/qt/qtquickcontrols/images/swipedelegate-background.9.png
/usr/share/doc/qt/qtquickcontrols/images/switch-handle-disabled.png
/usr/share/doc/qt/qtquickcontrols/images/switch-handle-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/switch-handle.png
/usr/share/doc/qt/qtquickcontrols/images/switch-indicator-checked-focused.png
/usr/share/doc/qt/qtquickcontrols/images/switch-indicator-checked-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/switch-indicator-checked-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/switch-indicator-checked.png
/usr/share/doc/qt/qtquickcontrols/images/switch-indicator-disabled.png
/usr/share/doc/qt/qtquickcontrols/images/switch-indicator-focused.png
/usr/share/doc/qt/qtquickcontrols/images/switch-indicator-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/switch-indicator-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/switch-indicator.png
/usr/share/doc/qt/qtquickcontrols/images/switchdelegate-background-disabled.9.png
/usr/share/doc/qt/qtquickcontrols/images/switchdelegate-background-focused.9.png
/usr/share/doc/qt/qtquickcontrols/images/switchdelegate-background-hovered.9.png
/usr/share/doc/qt/qtquickcontrols/images/switchdelegate-background-pressed.9.png
/usr/share/doc/qt/qtquickcontrols/images/switchdelegate-background.9.png
/usr/share/doc/qt/qtquickcontrols/images/switchdelegate-handle-disabled.png
/usr/share/doc/qt/qtquickcontrols/images/switchdelegate-handle.png
/usr/share/doc/qt/qtquickcontrols/images/switchdelegate-indicator-checked-focused.png
/usr/share/doc/qt/qtquickcontrols/images/switchdelegate-indicator-checked-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/switchdelegate-indicator-checked-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/switchdelegate-indicator-checked.png
/usr/share/doc/qt/qtquickcontrols/images/switchdelegate-indicator-disabled.png
/usr/share/doc/qt/qtquickcontrols/images/switchdelegate-indicator-focused.png
/usr/share/doc/qt/qtquickcontrols/images/switchdelegate-indicator-hovered.png
/usr/share/doc/qt/qtquickcontrols/images/switchdelegate-indicator-pressed.png
/usr/share/doc/qt/qtquickcontrols/images/switchdelegate-indicator.png
/usr/share/doc/qt/qtquickcontrols/images/tabbar-background.png
/usr/share/doc/qt/qtquickcontrols/images/tabbutton-background-checked.9.png
/usr/share/doc/qt/qtquickcontrols/images/tabbutton-background-disabled-checked.9.png
/usr/share/doc/qt/qtquickcontrols/images/tabbutton-background-disabled.9.png
/usr/share/doc/qt/qtquickcontrols/images/tabbutton-background-hovered.9.png
/usr/share/doc/qt/qtquickcontrols/images/tabbutton-background-pressed.9.png
/usr/share/doc/qt/qtquickcontrols/images/tabbutton-background.9.png
/usr/share/doc/qt/qtquickcontrols/images/textarea-background-disabled.9.png
/usr/share/doc/qt/qtquickcontrols/images/textarea-background-focused.9.png
/usr/share/doc/qt/qtquickcontrols/images/textarea-background.9.png
/usr/share/doc/qt/qtquickcontrols/images/textfield-background-disabled.9.png
/usr/share/doc/qt/qtquickcontrols/images/textfield-background-focused.9.png
/usr/share/doc/qt/qtquickcontrols/images/textfield-background.9.png
/usr/share/doc/qt/qtquickcontrols/images/toolbar-background.png
/usr/share/doc/qt/qtquickcontrols/images/toolbutton-background-checked-focused.9.png
/usr/share/doc/qt/qtquickcontrols/images/toolbutton-background-checked-hovered.9.png
/usr/share/doc/qt/qtquickcontrols/images/toolbutton-background-checked.9.png
/usr/share/doc/qt/qtquickcontrols/images/toolbutton-background-disabled-checked.9.png
/usr/share/doc/qt/qtquickcontrols/images/toolbutton-background-focused.9.png
/usr/share/doc/qt/qtquickcontrols/images/toolbutton-background-hovered.9.png
/usr/share/doc/qt/qtquickcontrols/images/toolbutton-background-pressed.9.png
/usr/share/doc/qt/qtquickcontrols/images/toolbutton-background.9.png
/usr/share/doc/qt/qtquickcontrols/images/toolseparator-separator-horizontal.9.png
/usr/share/doc/qt/qtquickcontrols/images/toolseparator-separator-vertical.9.png
/usr/share/doc/qt/qtquickcontrols/images/tooltip-background.9.png
/usr/share/doc/qt/qtquickcontrols/style/offline-simple.css
/usr/share/doc/qt/qtquickcontrols/style/offline.css
/usr/share/doc/qt/qtquickcontrols1/applicationwindow.html
/usr/share/doc/qt/qtquickcontrols1/controls.html
/usr/share/doc/qt/qtquickcontrols1/controlsstyling.html
/usr/share/doc/qt/qtquickcontrols1/examples-manifest.xml
/usr/share/doc/qt/qtquickcontrols1/menus.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-action-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-action.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-applicationwindow-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-applicationwindow.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-busyindicator-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-busyindicator.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-button-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-button.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-calendar-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-calendar.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-checkbox-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-checkbox.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-combobox-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-combobox.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-exclusivegroup-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-exclusivegroup.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-groupbox-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-groupbox.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-label-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-label.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-menu-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-menu.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-menubar-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-menubar.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-menuitem-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-menuitem.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-menuseparator-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-menuseparator.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-progressbar-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-progressbar.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-radiobutton-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-radiobutton.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-scrollview-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-scrollview.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-slider-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-slider.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-spinbox-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-spinbox.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-splitview-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-splitview.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-stack-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-stack.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-stackview-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-stackview.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-stackviewdelegate-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-stackviewdelegate.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-statusbar-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-statusbar.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-applicationwindowstyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-applicationwindowstyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-busyindicatorstyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-busyindicatorstyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-buttonstyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-buttonstyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-calendarstyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-calendarstyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-checkboxstyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-checkboxstyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-circulargaugestyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-circulargaugestyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-comboboxstyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-comboboxstyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-delaybuttonstyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-delaybuttonstyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-dialstyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-dialstyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-gaugestyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-gaugestyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-menubarstyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-menubarstyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-menustyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-menustyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-piemenustyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-piemenustyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-progressbarstyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-progressbarstyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-radiobuttonstyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-radiobuttonstyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-scrollviewstyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-scrollviewstyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-sliderstyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-sliderstyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-spinboxstyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-spinboxstyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-statusbarstyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-statusbarstyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-statusindicatorstyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-statusindicatorstyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-switchstyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-switchstyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-tableviewstyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-tableviewstyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-tabviewstyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-tabviewstyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-textareastyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-textareastyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-textfieldstyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-textfieldstyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-togglebuttonstyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-togglebuttonstyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-toolbarstyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-toolbarstyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-treeviewstyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-treeviewstyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-tumblerstyle-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-tumblerstyle-obsolete.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-styles-tumblerstyle.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-switch-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-switch.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-tab-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-tab.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-tableview-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-tableview.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-tableviewcolumn-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-tableviewcolumn.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-tabview-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-tabview.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-textarea-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-textarea.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-textfield-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-textfield.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-toolbar-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-toolbar.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-toolbutton-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-toolbutton.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-treeview-members.html
/usr/share/doc/qt/qtquickcontrols1/qml-qtquick-controls-treeview.html
/usr/share/doc/qt/qtquickcontrols1/qtquick-controls-qmlmodule.html
/usr/share/doc/qt/qtquickcontrols1/qtquick-controls-styles-qmlmodule.html
/usr/share/doc/qt/qtquickcontrols1/qtquickcontrols-examples.html
/usr/share/doc/qt/qtquickcontrols1/qtquickcontrols-overview.html
/usr/share/doc/qt/qtquickcontrols1/qtquickcontrols-platformnotes.html
/usr/share/doc/qt/qtquickcontrols1/qtquickcontrols1-calendar-example.html
/usr/share/doc/qt/qtquickcontrols1/qtquickcontrols1-filesystembrowser-example.html
/usr/share/doc/qt/qtquickcontrols1/qtquickcontrols1-gallery-example.html
/usr/share/doc/qt/qtquickcontrols1/qtquickcontrols1-index.html
/usr/share/doc/qt/qtquickcontrols1/qtquickcontrols1-styles-example.html
/usr/share/doc/qt/qtquickcontrols1/qtquickcontrols1-tableview-example.html
/usr/share/doc/qt/qtquickcontrols1/qtquickcontrols1-texteditor-example.html
/usr/share/doc/qt/qtquickcontrols1/qtquickcontrols1-touch-example.html
/usr/share/doc/qt/qtquickcontrols1/qtquickcontrols1-uiforms-example.html
/usr/share/doc/qt/qtquickcontrols1/qtquickcontrols1.index
/usr/share/doc/qt/qtquickcontrols1/qtquickcontrols1.qhp
/usr/share/doc/qt/qtquickcontrols1/qtquickcontrols1.qhp.sha1
/usr/share/doc/qt/qtquickcontrols1/qtquickcontrols1.tags
/usr/share/doc/qt/qtquickcontrols1/qtquickcontrolsstyles-index.html
/usr/share/doc/qt/qtquickcontrols1/styling-circulargauge.html
/usr/share/doc/qt/qtquickcontrols1/styling-gauge.html
/usr/share/doc/qt/qtquickcontrols1/stylingtutorials.html
/usr/share/doc/qt/qtquickcontrols1/views.html
/usr/share/doc/qt/qtquickcontrols1/viewsstyling.html
/usr/share/doc/qt/qtquickcontrols1/images/applicationwindow.png
/usr/share/doc/qt/qtquickcontrols1/images/arrow_bc.png
/usr/share/doc/qt/qtquickcontrols1/images/bgrContent.png
/usr/share/doc/qt/qtquickcontrols1/images/btn_next.png
/usr/share/doc/qt/qtquickcontrols1/images/btn_prev.png
/usr/share/doc/qt/qtquickcontrols1/images/bullet_dn.png
/usr/share/doc/qt/qtquickcontrols1/images/bullet_sq.png
/usr/share/doc/qt/qtquickcontrols1/images/busyindicator.png
/usr/share/doc/qt/qtquickcontrols1/images/button.png
/usr/share/doc/qt/qtquickcontrols1/images/calendar.png
/usr/share/doc/qt/qtquickcontrols1/images/calendarstyle-components-week-numbers.png
/usr/share/doc/qt/qtquickcontrols1/images/checkbox.png
/usr/share/doc/qt/qtquickcontrols1/images/circulargauge-angles.png
/usr/share/doc/qt/qtquickcontrols1/images/circulargauge-needle-example-2.png
/usr/share/doc/qt/qtquickcontrols1/images/circulargauge-needle.png
/usr/share/doc/qt/qtquickcontrols1/images/circulargauge-reversed.png
/usr/share/doc/qt/qtquickcontrols1/images/circulargauge-tickmark-indices-values.png
/usr/share/doc/qt/qtquickcontrols1/images/combobox.png
/usr/share/doc/qt/qtquickcontrols1/images/gauge-minorTickmark-example.png
/usr/share/doc/qt/qtquickcontrols1/images/gauge-temperature.png
/usr/share/doc/qt/qtquickcontrols1/images/gauge-tickmark-example.png
/usr/share/doc/qt/qtquickcontrols1/images/groupbox.png
/usr/share/doc/qt/qtquickcontrols1/images/home.png
/usr/share/doc/qt/qtquickcontrols1/images/ico_note.png
/usr/share/doc/qt/qtquickcontrols1/images/ico_note_attention.png
/usr/share/doc/qt/qtquickcontrols1/images/ico_out.png
/usr/share/doc/qt/qtquickcontrols1/images/label.png
/usr/share/doc/qt/qtquickcontrols1/images/logo.png
/usr/share/doc/qt/qtquickcontrols1/images/menu.png
/usr/share/doc/qt/qtquickcontrols1/images/menubar-action.png
/usr/share/doc/qt/qtquickcontrols1/images/menubar.png
/usr/share/doc/qt/qtquickcontrols1/images/piemenu-menuitem-example.png
/usr/share/doc/qt/qtquickcontrols1/images/progressbar.png
/usr/share/doc/qt/qtquickcontrols1/images/qtquickcontrols-example-calendar.png
/usr/share/doc/qt/qtquickcontrols1/images/qtquickcontrols-example-filesystembrowser.png
/usr/share/doc/qt/qtquickcontrols1/images/qtquickcontrols-example-gallery-android-dark.png
/usr/share/doc/qt/qtquickcontrols1/images/qtquickcontrols-example-gallery-android.png
/usr/share/doc/qt/qtquickcontrols1/images/qtquickcontrols-example-gallery-osx.png
/usr/share/doc/qt/qtquickcontrols1/images/qtquickcontrols-example-styles.png
/usr/share/doc/qt/qtquickcontrols1/images/qtquickcontrols-example-tableview.png
/usr/share/doc/qt/qtquickcontrols1/images/qtquickcontrols-example-text.png
/usr/share/doc/qt/qtquickcontrols1/images/qtquickcontrols-example-touch.png
/usr/share/doc/qt/qtquickcontrols1/images/qtquickcontrols-example-uiforms.png
/usr/share/doc/qt/qtquickcontrols1/images/radiobutton.png
/usr/share/doc/qt/qtquickcontrols1/images/scrollview.png
/usr/share/doc/qt/qtquickcontrols1/images/slider.png
/usr/share/doc/qt/qtquickcontrols1/images/spinbox.png
/usr/share/doc/qt/qtquickcontrols1/images/splitview.png
/usr/share/doc/qt/qtquickcontrols1/images/square-blue.png
/usr/share/doc/qt/qtquickcontrols1/images/square-green.png
/usr/share/doc/qt/qtquickcontrols1/images/square-red.png
/usr/share/doc/qt/qtquickcontrols1/images/square-white.png
/usr/share/doc/qt/qtquickcontrols1/images/square-yellow.png
/usr/share/doc/qt/qtquickcontrols1/images/stackview.png
/usr/share/doc/qt/qtquickcontrols1/images/styling-circulargauge-background-example.png
/usr/share/doc/qt/qtquickcontrols1/images/styling-circulargauge-knob-example.png
/usr/share/doc/qt/qtquickcontrols1/images/styling-circulargauge-minorTickmark-example.png
/usr/share/doc/qt/qtquickcontrols1/images/styling-circulargauge-needle-example.png
/usr/share/doc/qt/qtquickcontrols1/images/styling-circulargauge-tickmark-example.png
/usr/share/doc/qt/qtquickcontrols1/images/styling-circulargauge-tickmarkLabel-example.png
/usr/share/doc/qt/qtquickcontrols1/images/styling-gauge-font-size.png
/usr/share/doc/qt/qtquickcontrols1/images/styling-gauge-foreground.png
/usr/share/doc/qt/qtquickcontrols1/images/styling-gauge-minorTickmark.png
/usr/share/doc/qt/qtquickcontrols1/images/styling-gauge-tickmark.png
/usr/share/doc/qt/qtquickcontrols1/images/styling-gauge-valueBar.png
/usr/share/doc/qt/qtquickcontrols1/images/switch.png
/usr/share/doc/qt/qtquickcontrols1/images/tableview.png
/usr/share/doc/qt/qtquickcontrols1/images/tabview.png
/usr/share/doc/qt/qtquickcontrols1/images/textarea.png
/usr/share/doc/qt/qtquickcontrols1/images/textfield.png
/usr/share/doc/qt/qtquickcontrols1/images/toolbar.png
/usr/share/doc/qt/qtquickcontrols1/images/treeview.png
/usr/share/doc/qt/qtquickcontrols1/images/tumbler-flat-style.png
/usr/share/doc/qt/qtquickcontrols1/images/tumbler.png
/usr/share/doc/qt/qtquickcontrols1/style/offline-simple.css
/usr/share/doc/qt/qtquickcontrols1/style/offline.css
/usr/share/doc/qt/qtquickdialogs/examples-manifest.xml
/usr/share/doc/qt/qtquickdialogs/qml-qtquick-dialogs-colordialog-members.html
/usr/share/doc/qt/qtquickdialogs/qml-qtquick-dialogs-colordialog.html
/usr/share/doc/qt/qtquickdialogs/qml-qtquick-dialogs-dialog-members.html
/usr/share/doc/qt/qtquickdialogs/qml-qtquick-dialogs-dialog.html
/usr/share/doc/qt/qtquickdialogs/qml-qtquick-dialogs-filedialog-members.html
/usr/share/doc/qt/qtquickdialogs/qml-qtquick-dialogs-filedialog.html
/usr/share/doc/qt/qtquickdialogs/qml-qtquick-dialogs-fontdialog-members.html
/usr/share/doc/qt/qtquickdialogs/qml-qtquick-dialogs-fontdialog.html
/usr/share/doc/qt/qtquickdialogs/qml-qtquick-dialogs-messagedialog-members.html
/usr/share/doc/qt/qtquickdialogs/qml-qtquick-dialogs-messagedialog.html
/usr/share/doc/qt/qtquickdialogs/qtquick-dialogs-qmlmodule.html
/usr/share/doc/qt/qtquickdialogs/qtquickdialog-examples.html
/usr/share/doc/qt/qtquickdialogs/qtquickdialogs-index.html
/usr/share/doc/qt/qtquickdialogs/qtquickdialogs-systemdialogs-example.html
/usr/share/doc/qt/qtquickdialogs/qtquickdialogs.index
/usr/share/doc/qt/qtquickdialogs/qtquickdialogs.qhp
/usr/share/doc/qt/qtquickdialogs/qtquickdialogs.qhp.sha1
/usr/share/doc/qt/qtquickdialogs/images/arrow_bc.png
/usr/share/doc/qt/qtquickdialogs/images/bgrContent.png
/usr/share/doc/qt/qtquickdialogs/images/btn_next.png
/usr/share/doc/qt/qtquickdialogs/images/btn_prev.png
/usr/share/doc/qt/qtquickdialogs/images/bullet_dn.png
/usr/share/doc/qt/qtquickdialogs/images/bullet_sq.png
/usr/share/doc/qt/qtquickdialogs/images/critical.png
/usr/share/doc/qt/qtquickdialogs/images/home.png
/usr/share/doc/qt/qtquickdialogs/images/ico_note.png
/usr/share/doc/qt/qtquickdialogs/images/ico_note_attention.png
/usr/share/doc/qt/qtquickdialogs/images/ico_out.png
/usr/share/doc/qt/qtquickdialogs/images/information.png
/usr/share/doc/qt/qtquickdialogs/images/logo.png
/usr/share/doc/qt/qtquickdialogs/images/question.png
/usr/share/doc/qt/qtquickdialogs/images/replacefile.png
/usr/share/doc/qt/qtquickdialogs/images/systemdialogs-example.jpg
/usr/share/doc/qt/qtquickdialogs/images/warning.png
/usr/share/doc/qt/qtquickdialogs/style/offline-simple.css
/usr/share/doc/qt/qtquickdialogs/style/offline.css
/usr/share/doc/qt/qtquickextras/examples-manifest.xml
/usr/share/doc/qt/qtquickextras/qml-qtquick-extras-circulargauge-members.html
/usr/share/doc/qt/qtquickextras/qml-qtquick-extras-circulargauge.html
/usr/share/doc/qt/qtquickextras/qml-qtquick-extras-delaybutton-members.html
/usr/share/doc/qt/qtquickextras/qml-qtquick-extras-delaybutton.html
/usr/share/doc/qt/qtquickextras/qml-qtquick-extras-dial-members.html
/usr/share/doc/qt/qtquickextras/qml-qtquick-extras-dial.html
/usr/share/doc/qt/qtquickextras/qml-qtquick-extras-gauge-members.html
/usr/share/doc/qt/qtquickextras/qml-qtquick-extras-gauge.html
/usr/share/doc/qt/qtquickextras/qml-qtquick-extras-picture-members.html
/usr/share/doc/qt/qtquickextras/qml-qtquick-extras-picture.html
/usr/share/doc/qt/qtquickextras/qml-qtquick-extras-piemenu-members.html
/usr/share/doc/qt/qtquickextras/qml-qtquick-extras-piemenu-obsolete.html
/usr/share/doc/qt/qtquickextras/qml-qtquick-extras-piemenu.html
/usr/share/doc/qt/qtquickextras/qml-qtquick-extras-statusindicator-members.html
/usr/share/doc/qt/qtquickextras/qml-qtquick-extras-statusindicator-obsolete.html
/usr/share/doc/qt/qtquickextras/qml-qtquick-extras-statusindicator.html
/usr/share/doc/qt/qtquickextras/qml-qtquick-extras-togglebutton-members.html
/usr/share/doc/qt/qtquickextras/qml-qtquick-extras-togglebutton.html
/usr/share/doc/qt/qtquickextras/qml-qtquick-extras-tumbler-members.html
/usr/share/doc/qt/qtquickextras/qml-qtquick-extras-tumbler.html
/usr/share/doc/qt/qtquickextras/qml-qtquick-extras-tumblercolumn-members.html
/usr/share/doc/qt/qtquickextras/qml-qtquick-extras-tumblercolumn.html
/usr/share/doc/qt/qtquickextras/qtquick-extras-qmlmodule.html
/usr/share/doc/qt/qtquickextras/qtquickextras-dashboard-example.html
/usr/share/doc/qt/qtquickextras/qtquickextras-examples.html
/usr/share/doc/qt/qtquickextras/qtquickextras-flat-example.html
/usr/share/doc/qt/qtquickextras/qtquickextras-gallery-example.html
/usr/share/doc/qt/qtquickextras/qtquickextras-index.html
/usr/share/doc/qt/qtquickextras/qtquickextras-overview.html
/usr/share/doc/qt/qtquickextras/qtquickextras.index
/usr/share/doc/qt/qtquickextras/qtquickextras.qhp
/usr/share/doc/qt/qtquickextras/qtquickextras.qhp.sha1
/usr/share/doc/qt/qtquickextras/images/arrow_bc.png
/usr/share/doc/qt/qtquickextras/images/bgrContent.png
/usr/share/doc/qt/qtquickextras/images/btn_next.png
/usr/share/doc/qt/qtquickextras/images/btn_prev.png
/usr/share/doc/qt/qtquickextras/images/bullet_dn.png
/usr/share/doc/qt/qtquickextras/images/bullet_sq.png
/usr/share/doc/qt/qtquickextras/images/circulargauge.png
/usr/share/doc/qt/qtquickextras/images/delaybutton-activated.png
/usr/share/doc/qt/qtquickextras/images/delaybutton-progress.png
/usr/share/doc/qt/qtquickextras/images/delaybutton.png
/usr/share/doc/qt/qtquickextras/images/dial.png
/usr/share/doc/qt/qtquickextras/images/gauge.png
/usr/share/doc/qt/qtquickextras/images/home.png
/usr/share/doc/qt/qtquickextras/images/ico_note.png
/usr/share/doc/qt/qtquickextras/images/ico_note_attention.png
/usr/share/doc/qt/qtquickextras/images/ico_out.png
/usr/share/doc/qt/qtquickextras/images/logo.png
/usr/share/doc/qt/qtquickextras/images/piemenu-boundingItem-example.png
/usr/share/doc/qt/qtquickextras/images/piemenu-boundingItem-null-example.png
/usr/share/doc/qt/qtquickextras/images/piemenu.png
/usr/share/doc/qt/qtquickextras/images/qtquickextras-example-dashboard.png
/usr/share/doc/qt/qtquickextras/images/qtquickextras-example-flat.png
/usr/share/doc/qt/qtquickextras/images/qtquickextras-example-gallery.png
/usr/share/doc/qt/qtquickextras/images/statusindicator-active.png
/usr/share/doc/qt/qtquickextras/images/statusindicator-green.png
/usr/share/doc/qt/qtquickextras/images/statusindicator-inactive.png
/usr/share/doc/qt/qtquickextras/images/togglebutton-checked.png
/usr/share/doc/qt/qtquickextras/images/togglebutton-unchecked.png
/usr/share/doc/qt/qtquickextras/images/tumbler.png
/usr/share/doc/qt/qtquickextras/style/offline-simple.css
/usr/share/doc/qt/qtquickextras/style/offline.css
/usr/share/doc/qt/qtremoteobjects/qml-qtremoteobjects-node-members.html
/usr/share/doc/qt/qtremoteobjects/qml-qtremoteobjects-node.html
/usr/share/doc/qt/qtremoteobjects/qml-qtremoteobjects-settingsstore-members.html
/usr/share/doc/qt/qtremoteobjects/qml-qtremoteobjects-settingsstore.html
/usr/share/doc/qt/qtremoteobjects/qremoteobjectabstractpersistedstore-members.html
/usr/share/doc/qt/qtremoteobjects/qremoteobjectabstractpersistedstore.html
/usr/share/doc/qt/qtremoteobjects/qremoteobjectdynamicreplica-members.html
/usr/share/doc/qt/qtremoteobjects/qremoteobjectdynamicreplica.html
/usr/share/doc/qt/qtremoteobjects/qremoteobjecthost-members.html
/usr/share/doc/qt/qtremoteobjects/qremoteobjecthost.html
/usr/share/doc/qt/qtremoteobjects/qremoteobjecthostbase-members.html
/usr/share/doc/qt/qtremoteobjects/qremoteobjecthostbase.html
/usr/share/doc/qt/qtremoteobjects/qremoteobjectnode-members.html
/usr/share/doc/qt/qtremoteobjects/qremoteobjectnode.html
/usr/share/doc/qt/qtremoteobjects/qremoteobjectregistry-members.html
/usr/share/doc/qt/qtremoteobjects/qremoteobjectregistry.html
/usr/share/doc/qt/qtremoteobjects/qremoteobjectregistryhost-members.html
/usr/share/doc/qt/qtremoteobjects/qremoteobjectregistryhost.html
/usr/share/doc/qt/qtremoteobjects/qremoteobjectreplica-members.html
/usr/share/doc/qt/qtremoteobjects/qremoteobjectreplica.html
/usr/share/doc/qt/qtremoteobjects/qtremoteobjects-compatibility.html
/usr/share/doc/qt/qtremoteobjects/qtremoteobjects-external-schemas.html
/usr/share/doc/qt/qtremoteobjects/qtremoteobjects-gettingstarted.html
/usr/share/doc/qt/qtremoteobjects/qtremoteobjects-index.html
/usr/share/doc/qt/qtremoteobjects/qtremoteobjects-interaction.html
/usr/share/doc/qt/qtremoteobjects/qtremoteobjects-module.html
/usr/share/doc/qt/qtremoteobjects/qtremoteobjects-node.html
/usr/share/doc/qt/qtremoteobjects/qtremoteobjects-qmlmodule.html
/usr/share/doc/qt/qtremoteobjects/qtremoteobjects-registry.html
/usr/share/doc/qt/qtremoteobjects/qtremoteobjects-repc.html
/usr/share/doc/qt/qtremoteobjects/qtremoteobjects-replica.html
/usr/share/doc/qt/qtremoteobjects/qtremoteobjects-source.html
/usr/share/doc/qt/qtremoteobjects/qtremoteobjects-troubleshooting.html
/usr/share/doc/qt/qtremoteobjects/qtremoteobjects.index
/usr/share/doc/qt/qtremoteobjects/qtremoteobjects.qhp
/usr/share/doc/qt/qtremoteobjects/qtremoteobjects.qhp.sha1
/usr/share/doc/qt/qtremoteobjects/qtremoteobjects.tags
/usr/share/doc/qt/qtremoteobjects/qtroclientfactory.html
/usr/share/doc/qt/qtremoteobjects/qtroserverfactory.html
/usr/share/doc/qt/qtremoteobjects/remoteobjects-example-dynamic-replica.html
/usr/share/doc/qt/qtremoteobjects/remoteobjects-example-registry.html
/usr/share/doc/qt/qtremoteobjects/remoteobjects-example-static-source.html
/usr/share/doc/qt/qtremoteobjects/images/DirectConnectClientServerOutput.png
/usr/share/doc/qt/qtremoteobjects/images/DirectConnectServerOutput.png
/usr/share/doc/qt/qtremoteobjects/images/arrow_bc.png
/usr/share/doc/qt/qtremoteobjects/images/bgrContent.png
/usr/share/doc/qt/qtremoteobjects/images/btn_next.png
/usr/share/doc/qt/qtremoteobjects/images/btn_prev.png
/usr/share/doc/qt/qtremoteobjects/images/bullet_dn.png
/usr/share/doc/qt/qtremoteobjects/images/bullet_sq.png
/usr/share/doc/qt/qtremoteobjects/images/home.png
/usr/share/doc/qt/qtremoteobjects/images/ico_note.png
/usr/share/doc/qt/qtremoteobjects/images/ico_note_attention.png
/usr/share/doc/qt/qtremoteobjects/images/ico_out.png
/usr/share/doc/qt/qtremoteobjects/images/logo.png
/usr/share/doc/qt/qtremoteobjects/style/offline-simple.css
/usr/share/doc/qt/qtremoteobjects/style/offline.css
/usr/share/doc/qt/qtscript/ecmascript.html
/usr/share/doc/qt/qtscript/examples-manifest.xml
/usr/share/doc/qt/qtscript/qscriptable-members.html
/usr/share/doc/qt/qtscript/qscriptable.html
/usr/share/doc/qt/qtscript/qscriptclass-members.html
/usr/share/doc/qt/qtscript/qscriptclass.html
/usr/share/doc/qt/qtscript/qscriptclasspropertyiterator-members.html
/usr/share/doc/qt/qtscript/qscriptclasspropertyiterator.html
/usr/share/doc/qt/qtscript/qscriptcontext-members.html
/usr/share/doc/qt/qtscript/qscriptcontext.html
/usr/share/doc/qt/qtscript/qscriptcontextinfo-members.html
/usr/share/doc/qt/qtscript/qscriptcontextinfo-obsolete.html
/usr/share/doc/qt/qtscript/qscriptcontextinfo.html
/usr/share/doc/qt/qtscript/qscriptengine-members.html
/usr/share/doc/qt/qtscript/qscriptengine-obsolete.html
/usr/share/doc/qt/qtscript/qscriptengine.html
/usr/share/doc/qt/qtscript/qscriptengineagent-members.html
/usr/share/doc/qt/qtscript/qscriptengineagent.html
/usr/share/doc/qt/qtscript/qscriptextensionplugin-members.html
/usr/share/doc/qt/qtscript/qscriptextensionplugin.html
/usr/share/doc/qt/qtscript/qscriptprogram-members.html
/usr/share/doc/qt/qtscript/qscriptprogram.html
/usr/share/doc/qt/qtscript/qscriptstring-members.html
/usr/share/doc/qt/qtscript/qscriptstring.html
/usr/share/doc/qt/qtscript/qscriptsyntaxcheckresult-members.html
/usr/share/doc/qt/qtscript/qscriptsyntaxcheckresult.html
/usr/share/doc/qt/qtscript/qscriptvalue-members.html
/usr/share/doc/qt/qtscript/qscriptvalue-obsolete.html
/usr/share/doc/qt/qtscript/qscriptvalue.html
/usr/share/doc/qt/qtscript/qscriptvalueiterator-members.html
/usr/share/doc/qt/qtscript/qscriptvalueiterator.html
/usr/share/doc/qt/qtscript/qtscript-attribution-benchmarks-sunspider.html
/usr/share/doc/qt/qtscript/qtscript-attribution-benchmarks-v8.html
/usr/share/doc/qt/qtscript/qtscript-attribution-javascriptcore.html
/usr/share/doc/qt/qtscript/qtscript-index.html
/usr/share/doc/qt/qtscript/qtscript-module.html
/usr/share/doc/qt/qtscript/qtscript-script-context2d-example.html
/usr/share/doc/qt/qtscript/qtscript-script-defaultprototypes-example.html
/usr/share/doc/qt/qtscript/qtscript-script-helloscript-example.html
/usr/share/doc/qt/qtscript/qtscript.index
/usr/share/doc/qt/qtscript/qtscript.qhp
/usr/share/doc/qt/qtscript/qtscript.qhp.sha1
/usr/share/doc/qt/qtscript/qtscriptdebugger-manual.html
/usr/share/doc/qt/qtscript/qtscriptextensions.html
/usr/share/doc/qt/qtscript/script.html
/usr/share/doc/qt/qtscript/images/arrow_bc.png
/usr/share/doc/qt/qtscript/images/bgrContent.png
/usr/share/doc/qt/qtscript/images/btn_next.png
/usr/share/doc/qt/qtscript/images/btn_prev.png
/usr/share/doc/qt/qtscript/images/bullet_dn.png
/usr/share/doc/qt/qtscript/images/bullet_sq.png
/usr/share/doc/qt/qtscript/images/context2d-example-smileysmile.png
/usr/share/doc/qt/qtscript/images/context2d-example.png
/usr/share/doc/qt/qtscript/images/defaultprototypes-example.png
/usr/share/doc/qt/qtscript/images/home.png
/usr/share/doc/qt/qtscript/images/ico_note.png
/usr/share/doc/qt/qtscript/images/ico_note_attention.png
/usr/share/doc/qt/qtscript/images/ico_out.png
/usr/share/doc/qt/qtscript/images/logo.png
/usr/share/doc/qt/qtscript/images/qtscript-debugger.png
/usr/share/doc/qt/qtscript/style/offline-simple.css
/usr/share/doc/qt/qtscript/style/offline.css
/usr/share/doc/qt/qtscripttools/qscriptenginedebugger-members.html
/usr/share/doc/qt/qtscripttools/qscriptenginedebugger.html
/usr/share/doc/qt/qtscripttools/qtscripttools-index.html
/usr/share/doc/qt/qtscripttools/qtscripttools-module.html
/usr/share/doc/qt/qtscripttools/qtscripttools.index
/usr/share/doc/qt/qtscripttools/qtscripttools.qhp
/usr/share/doc/qt/qtscripttools/qtscripttools.qhp.sha1
/usr/share/doc/qt/qtscripttools/images/arrow_bc.png
/usr/share/doc/qt/qtscripttools/images/bgrContent.png
/usr/share/doc/qt/qtscripttools/images/btn_next.png
/usr/share/doc/qt/qtscripttools/images/btn_prev.png
/usr/share/doc/qt/qtscripttools/images/bullet_dn.png
/usr/share/doc/qt/qtscripttools/images/bullet_sq.png
/usr/share/doc/qt/qtscripttools/images/home.png
/usr/share/doc/qt/qtscripttools/images/ico_note.png
/usr/share/doc/qt/qtscripttools/images/ico_note_attention.png
/usr/share/doc/qt/qtscripttools/images/ico_out.png
/usr/share/doc/qt/qtscripttools/images/logo.png
/usr/share/doc/qt/qtscripttools/style/offline-simple.css
/usr/share/doc/qt/qtscripttools/style/offline.css
/usr/share/doc/qt/qtscxml/examples-manifest.xml
/usr/share/doc/qt/qtscxml/examples-qtscxml.html
/usr/share/doc/qt/qtscxml/qml-mediaplayer-qml-dynamic-members.html
/usr/share/doc/qt/qtscxml/qml-mediaplayer-qml-dynamic.html
/usr/share/doc/qt/qtscxml/qml-qtscxml-eventconnection-members.html
/usr/share/doc/qt/qtscxml/qml-qtscxml-eventconnection.html
/usr/share/doc/qt/qtscxml/qml-qtscxml-invokedservices-members.html
/usr/share/doc/qt/qtscxml/qml-qtscxml-invokedservices.html
/usr/share/doc/qt/qtscxml/qml-qtscxml-scxmlstatemachine-members.html
/usr/share/doc/qt/qtscxml/qml-qtscxml-scxmlstatemachine.html
/usr/share/doc/qt/qtscxml/qml-qtscxml-statemachineloader-members.html
/usr/share/doc/qt/qtscxml/qml-qtscxml-statemachineloader.html
/usr/share/doc/qt/qtscxml/qscxmlc.html
/usr/share/doc/qt/qtscxml/qscxmlcompiler-loader-members.html
/usr/share/doc/qt/qtscxml/qscxmlcompiler-loader.html
/usr/share/doc/qt/qtscxml/qscxmlcompiler-members.html
/usr/share/doc/qt/qtscxml/qscxmlcompiler.html
/usr/share/doc/qt/qtscxml/qscxmlcppdatamodel-members.html
/usr/share/doc/qt/qtscxml/qscxmlcppdatamodel.html
/usr/share/doc/qt/qtscxml/qscxmldatamodel-foreachloopbody-members.html
/usr/share/doc/qt/qtscxml/qscxmldatamodel-foreachloopbody.html
/usr/share/doc/qt/qtscxml/qscxmldatamodel-members.html
/usr/share/doc/qt/qtscxml/qscxmldatamodel.html
/usr/share/doc/qt/qtscxml/qscxmldynamicscxmlservicefactory-members.html
/usr/share/doc/qt/qtscxml/qscxmldynamicscxmlservicefactory.html
/usr/share/doc/qt/qtscxml/qscxmlecmascriptdatamodel-members.html
/usr/share/doc/qt/qtscxml/qscxmlecmascriptdatamodel.html
/usr/share/doc/qt/qtscxml/qscxmlerror-members.html
/usr/share/doc/qt/qtscxml/qscxmlerror.html
/usr/share/doc/qt/qtscxml/qscxmlevent-members.html
/usr/share/doc/qt/qtscxml/qscxmlevent.html
/usr/share/doc/qt/qtscxml/qscxmlexecutablecontent-assignmentinfo-members.html
/usr/share/doc/qt/qtscxml/qscxmlexecutablecontent-assignmentinfo.html
/usr/share/doc/qt/qtscxml/qscxmlexecutablecontent-evaluatorinfo-members.html
/usr/share/doc/qt/qtscxml/qscxmlexecutablecontent-evaluatorinfo.html
/usr/share/doc/qt/qtscxml/qscxmlexecutablecontent-foreachinfo-members.html
/usr/share/doc/qt/qtscxml/qscxmlexecutablecontent-foreachinfo.html
/usr/share/doc/qt/qtscxml/qscxmlexecutablecontent-invokeinfo-members.html
/usr/share/doc/qt/qtscxml/qscxmlexecutablecontent-invokeinfo.html
/usr/share/doc/qt/qtscxml/qscxmlexecutablecontent-parameterinfo-members.html
/usr/share/doc/qt/qtscxml/qscxmlexecutablecontent-parameterinfo.html
/usr/share/doc/qt/qtscxml/qscxmlexecutablecontent.html
/usr/share/doc/qt/qtscxml/qscxmlinvokableservice-members.html
/usr/share/doc/qt/qtscxml/qscxmlinvokableservice.html
/usr/share/doc/qt/qtscxml/qscxmlinvokableservicefactory-members.html
/usr/share/doc/qt/qtscxml/qscxmlinvokableservicefactory.html
/usr/share/doc/qt/qtscxml/qscxmlnulldatamodel-members.html
/usr/share/doc/qt/qtscxml/qscxmlnulldatamodel.html
/usr/share/doc/qt/qtscxml/qscxmlstatemachine-members.html
/usr/share/doc/qt/qtscxml/qscxmlstatemachine.html
/usr/share/doc/qt/qtscxml/qscxmlstaticscxmlservicefactory-members.html
/usr/share/doc/qt/qtscxml/qscxmlstaticscxmlservicefactory.html
/usr/share/doc/qt/qtscxml/qscxmltabledata-members.html
/usr/share/doc/qt/qtscxml/qscxmltabledata.html
/usr/share/doc/qt/qtscxml/qtscxml-calculator-qml-example.html
/usr/share/doc/qt/qtscxml/qtscxml-calculator-widgets-example.html
/usr/share/doc/qt/qtscxml/qtscxml-ftpclient-example.html
/usr/share/doc/qt/qtscxml/qtscxml-index.html
/usr/share/doc/qt/qtscxml/qtscxml-instantiating-state-machines.html
/usr/share/doc/qt/qtscxml/qtscxml-invoke-dynamic-example.html
/usr/share/doc/qt/qtscxml/qtscxml-invoke-static-example.html
/usr/share/doc/qt/qtscxml/qtscxml-mediaplayer-qml-cppdatamodel-example.html
/usr/share/doc/qt/qtscxml/qtscxml-mediaplayer-qml-dynamic-example.html
/usr/share/doc/qt/qtscxml/qtscxml-mediaplayer-qml-static-example.html
/usr/share/doc/qt/qtscxml/qtscxml-mediaplayer-widgets-dynamic-example.html
/usr/share/doc/qt/qtscxml/qtscxml-mediaplayer-widgets-static-example.html
/usr/share/doc/qt/qtscxml/qtscxml-module.html
/usr/share/doc/qt/qtscxml/qtscxml-overview.html
/usr/share/doc/qt/qtscxml/qtscxml-pinball-example.html
/usr/share/doc/qt/qtscxml/qtscxml-qmlmodule.html
/usr/share/doc/qt/qtscxml/qtscxml-scxml-compliance.html
/usr/share/doc/qt/qtscxml/qtscxml-sudoku-example.html
/usr/share/doc/qt/qtscxml/qtscxml-trafficlight-qml-dynamic-example.html
/usr/share/doc/qt/qtscxml/qtscxml-trafficlight-qml-simple-example.html
/usr/share/doc/qt/qtscxml/qtscxml-trafficlight-qml-static-example.html
/usr/share/doc/qt/qtscxml/qtscxml-trafficlight-widgets-dynamic-example.html
/usr/share/doc/qt/qtscxml/qtscxml-trafficlight-widgets-static-example.html
/usr/share/doc/qt/qtscxml/qtscxml.index
/usr/share/doc/qt/qtscxml/qtscxml.qhp
/usr/share/doc/qt/qtscxml/qtscxml.qhp.sha1
/usr/share/doc/qt/qtscxml/qtscxml.tags
/usr/share/doc/qt/qtscxml/images/arrow_bc.png
/usr/share/doc/qt/qtscxml/images/bgrContent.png
/usr/share/doc/qt/qtscxml/images/btn_next.png
/usr/share/doc/qt/qtscxml/images/btn_prev.png
/usr/share/doc/qt/qtscxml/images/bullet_dn.png
/usr/share/doc/qt/qtscxml/images/bullet_sq.png
/usr/share/doc/qt/qtscxml/images/calculator-qml.png
/usr/share/doc/qt/qtscxml/images/calculator.png
/usr/share/doc/qt/qtscxml/images/ftpclient-statechart.png
/usr/share/doc/qt/qtscxml/images/home.png
/usr/share/doc/qt/qtscxml/images/ico_note.png
/usr/share/doc/qt/qtscxml/images/ico_note_attention.png
/usr/share/doc/qt/qtscxml/images/ico_out.png
/usr/share/doc/qt/qtscxml/images/invoke-dynamic.png
/usr/share/doc/qt/qtscxml/images/invoke-static.png
/usr/share/doc/qt/qtscxml/images/logo.png
/usr/share/doc/qt/qtscxml/images/mediaplayer.png
/usr/share/doc/qt/qtscxml/images/pinball-statechart-global.png
/usr/share/doc/qt/qtscxml/images/pinball-statechart-guicontrol.png
/usr/share/doc/qt/qtscxml/images/pinball-statechart-internalstate.png
/usr/share/doc/qt/qtscxml/images/pinball-statechart-logicalstate.png
/usr/share/doc/qt/qtscxml/images/pinball-statechart-modestate.png
/usr/share/doc/qt/qtscxml/images/pinball-statechart-onstate.png
/usr/share/doc/qt/qtscxml/images/pinball-statechart-workflow.png
/usr/share/doc/qt/qtscxml/images/pinball.png
/usr/share/doc/qt/qtscxml/images/sudoku.png
/usr/share/doc/qt/qtscxml/images/trafficlight.png
/usr/share/doc/qt/qtscxml/style/offline-simple.css
/usr/share/doc/qt/qtscxml/style/offline.css
/usr/share/doc/qt/qtsensors/compatmap.html
/usr/share/doc/qt/qtsensors/creating-a-sensor-plugin.html
/usr/share/doc/qt/qtsensors/determining-the-default-sensor-for-a-type.html
/usr/share/doc/qt/qtsensors/dynamic-sensor-backend-registration.html
/usr/share/doc/qt/qtsensors/examples-manifest.xml
/usr/share/doc/qt/qtsensors/genericbackend.html
/usr/share/doc/qt/qtsensors/qaccelerometer-members.html
/usr/share/doc/qt/qtsensors/qaccelerometer.html
/usr/share/doc/qt/qtsensors/qaccelerometerfilter-members.html
/usr/share/doc/qt/qtsensors/qaccelerometerfilter.html
/usr/share/doc/qt/qtsensors/qaccelerometerreading-members.html
/usr/share/doc/qt/qtsensors/qaccelerometerreading.html
/usr/share/doc/qt/qtsensors/qaltimeter-members.html
/usr/share/doc/qt/qtsensors/qaltimeter.html
/usr/share/doc/qt/qtsensors/qaltimeterfilter-members.html
/usr/share/doc/qt/qtsensors/qaltimeterfilter.html
/usr/share/doc/qt/qtsensors/qaltimeterreading-members.html
/usr/share/doc/qt/qtsensors/qaltimeterreading.html
/usr/share/doc/qt/qtsensors/qambientlightfilter-members.html
/usr/share/doc/qt/qtsensors/qambientlightfilter.html
/usr/share/doc/qt/qtsensors/qambientlightreading-members.html
/usr/share/doc/qt/qtsensors/qambientlightreading.html
/usr/share/doc/qt/qtsensors/qambientlightsensor-members.html
/usr/share/doc/qt/qtsensors/qambientlightsensor.html
/usr/share/doc/qt/qtsensors/qambienttemperaturefilter-members.html
/usr/share/doc/qt/qtsensors/qambienttemperaturefilter.html
/usr/share/doc/qt/qtsensors/qambienttemperaturereading-members.html
/usr/share/doc/qt/qtsensors/qambienttemperaturereading.html
/usr/share/doc/qt/qtsensors/qambienttemperaturesensor-members.html
/usr/share/doc/qt/qtsensors/qambienttemperaturesensor.html
/usr/share/doc/qt/qtsensors/qcompass-members.html
/usr/share/doc/qt/qtsensors/qcompass.html
/usr/share/doc/qt/qtsensors/qcompassfilter-members.html
/usr/share/doc/qt/qtsensors/qcompassfilter.html
/usr/share/doc/qt/qtsensors/qcompassreading-members.html
/usr/share/doc/qt/qtsensors/qcompassreading.html
/usr/share/doc/qt/qtsensors/qdistancefilter-members.html
/usr/share/doc/qt/qtsensors/qdistancefilter.html
/usr/share/doc/qt/qtsensors/qdistancereading-members.html
/usr/share/doc/qt/qtsensors/qdistancereading.html
/usr/share/doc/qt/qtsensors/qdistancesensor-members.html
/usr/share/doc/qt/qtsensors/qdistancesensor.html
/usr/share/doc/qt/qtsensors/qgyroscope-members.html
/usr/share/doc/qt/qtsensors/qgyroscope.html
/usr/share/doc/qt/qtsensors/qgyroscopefilter-members.html
/usr/share/doc/qt/qtsensors/qgyroscopefilter.html
/usr/share/doc/qt/qtsensors/qgyroscopereading-members.html
/usr/share/doc/qt/qtsensors/qgyroscopereading.html
/usr/share/doc/qt/qtsensors/qholsterfilter-members.html
/usr/share/doc/qt/qtsensors/qholsterfilter.html
/usr/share/doc/qt/qtsensors/qholsterreading-members.html
/usr/share/doc/qt/qtsensors/qholsterreading.html
/usr/share/doc/qt/qtsensors/qholstersensor-members.html
/usr/share/doc/qt/qtsensors/qholstersensor.html
/usr/share/doc/qt/qtsensors/qhumidityfilter-members.html
/usr/share/doc/qt/qtsensors/qhumidityfilter.html
/usr/share/doc/qt/qtsensors/qhumidityreading-members.html
/usr/share/doc/qt/qtsensors/qhumidityreading.html
/usr/share/doc/qt/qtsensors/qhumiditysensor-members.html
/usr/share/doc/qt/qtsensors/qhumiditysensor.html
/usr/share/doc/qt/qtsensors/qirproximityfilter-members.html
/usr/share/doc/qt/qtsensors/qirproximityfilter.html
/usr/share/doc/qt/qtsensors/qirproximityreading-members.html
/usr/share/doc/qt/qtsensors/qirproximityreading.html
/usr/share/doc/qt/qtsensors/qirproximitysensor-members.html
/usr/share/doc/qt/qtsensors/qirproximitysensor.html
/usr/share/doc/qt/qtsensors/qlidfilter-members.html
/usr/share/doc/qt/qtsensors/qlidfilter.html
/usr/share/doc/qt/qtsensors/qlidreading-members.html
/usr/share/doc/qt/qtsensors/qlidreading.html
/usr/share/doc/qt/qtsensors/qlidsensor-members.html
/usr/share/doc/qt/qtsensors/qlidsensor.html
/usr/share/doc/qt/qtsensors/qlightfilter-members.html
/usr/share/doc/qt/qtsensors/qlightfilter.html
/usr/share/doc/qt/qtsensors/qlightreading-members.html
/usr/share/doc/qt/qtsensors/qlightreading.html
/usr/share/doc/qt/qtsensors/qlightsensor-members.html
/usr/share/doc/qt/qtsensors/qlightsensor.html
/usr/share/doc/qt/qtsensors/qmagnetometer-members.html
/usr/share/doc/qt/qtsensors/qmagnetometer.html
/usr/share/doc/qt/qtsensors/qmagnetometerfilter-members.html
/usr/share/doc/qt/qtsensors/qmagnetometerfilter.html
/usr/share/doc/qt/qtsensors/qmagnetometerreading-members.html
/usr/share/doc/qt/qtsensors/qmagnetometerreading.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-accelerometer-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-accelerometer.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-accelerometerreading-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-accelerometerreading.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-altimeter-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-altimeter.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-altimeterreading-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-altimeterreading.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-ambientlightreading-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-ambientlightreading.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-ambientlightsensor-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-ambientlightsensor.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-ambienttemperaturereading-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-ambienttemperaturereading.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-ambienttemperaturesensor-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-ambienttemperaturesensor.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-compass-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-compass.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-compassreading-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-compassreading.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-distancereading-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-distancereading.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-distancesensor-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-distancesensor.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-gyroscope-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-gyroscope.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-gyroscopereading-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-gyroscopereading.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-holsterreading-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-holsterreading.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-holstersensor-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-holstersensor.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-humidityreading-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-humidityreading.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-humiditysensor-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-humiditysensor.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-irproximityreading-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-irproximityreading.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-irproximitysensor-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-irproximitysensor.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-lidreading-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-lidreading.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-lidsensor-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-lidsensor.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-lightreading-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-lightreading.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-lightsensor-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-lightsensor.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-magnetometer-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-magnetometer.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-magnetometerreading-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-magnetometerreading.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-orientationreading-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-orientationreading.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-orientationsensor-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-orientationsensor.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-pressurereading-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-pressurereading.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-pressuresensor-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-pressuresensor.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-proximityreading-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-proximityreading.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-proximitysensor-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-proximitysensor.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-qmlsensors-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-qmlsensors.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-rotationreading-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-rotationreading.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-rotationsensor-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-rotationsensor.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-sensor-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-sensor.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-sensorgesture-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-sensorgesture.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-sensorreading-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-sensorreading.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-tapreading-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-tapreading.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-tapsensor-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-tapsensor.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-tiltreading-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-tiltreading.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-tiltsensor-members.html
/usr/share/doc/qt/qtsensors/qml-qtsensors-tiltsensor.html
/usr/share/doc/qt/qtsensors/qorientationfilter-members.html
/usr/share/doc/qt/qtsensors/qorientationfilter.html
/usr/share/doc/qt/qtsensors/qorientationreading-members.html
/usr/share/doc/qt/qtsensors/qorientationreading.html
/usr/share/doc/qt/qtsensors/qorientationsensor-members.html
/usr/share/doc/qt/qtsensors/qorientationsensor.html
/usr/share/doc/qt/qtsensors/qoutputrange-members.html
/usr/share/doc/qt/qtsensors/qoutputrange.html
/usr/share/doc/qt/qtsensors/qpressurefilter-members.html
/usr/share/doc/qt/qtsensors/qpressurefilter.html
/usr/share/doc/qt/qtsensors/qpressurereading-members.html
/usr/share/doc/qt/qtsensors/qpressurereading.html
/usr/share/doc/qt/qtsensors/qpressuresensor-members.html
/usr/share/doc/qt/qtsensors/qpressuresensor.html
/usr/share/doc/qt/qtsensors/qproximityfilter-members.html
/usr/share/doc/qt/qtsensors/qproximityfilter.html
/usr/share/doc/qt/qtsensors/qproximityreading-members.html
/usr/share/doc/qt/qtsensors/qproximityreading.html
/usr/share/doc/qt/qtsensors/qproximitysensor-members.html
/usr/share/doc/qt/qtsensors/qproximitysensor.html
/usr/share/doc/qt/qtsensors/qrotationfilter-members.html
/usr/share/doc/qt/qtsensors/qrotationfilter.html
/usr/share/doc/qt/qtsensors/qrotationreading-members.html
/usr/share/doc/qt/qtsensors/qrotationreading.html
/usr/share/doc/qt/qtsensors/qrotationsensor-members.html
/usr/share/doc/qt/qtsensors/qrotationsensor.html
/usr/share/doc/qt/qtsensors/qsensor-members.html
/usr/share/doc/qt/qtsensors/qsensor.html
/usr/share/doc/qt/qtsensors/qsensorbackend-members.html
/usr/share/doc/qt/qtsensors/qsensorbackend.html
/usr/share/doc/qt/qtsensors/qsensorbackendfactory-members.html
/usr/share/doc/qt/qtsensors/qsensorbackendfactory.html
/usr/share/doc/qt/qtsensors/qsensorchangesinterface-members.html
/usr/share/doc/qt/qtsensors/qsensorchangesinterface.html
/usr/share/doc/qt/qtsensors/qsensorfilter-members.html
/usr/share/doc/qt/qtsensors/qsensorfilter.html
/usr/share/doc/qt/qtsensors/qsensorgesture-members.html
/usr/share/doc/qt/qtsensors/qsensorgesture.html
/usr/share/doc/qt/qtsensors/qsensorgesturemanager-members.html
/usr/share/doc/qt/qtsensors/qsensorgesturemanager.html
/usr/share/doc/qt/qtsensors/qsensorgestureplugininterface-members.html
/usr/share/doc/qt/qtsensors/qsensorgestureplugininterface.html
/usr/share/doc/qt/qtsensors/qsensorgesturerecognizer-members.html
/usr/share/doc/qt/qtsensors/qsensorgesturerecognizer.html
/usr/share/doc/qt/qtsensors/qsensormanager-members.html
/usr/share/doc/qt/qtsensors/qsensormanager.html
/usr/share/doc/qt/qtsensors/qsensorplugininterface-members.html
/usr/share/doc/qt/qtsensors/qsensorplugininterface.html
/usr/share/doc/qt/qtsensors/qsensorreading-members.html
/usr/share/doc/qt/qtsensors/qsensorreading.html
/usr/share/doc/qt/qtsensors/qtapfilter-members.html
/usr/share/doc/qt/qtsensors/qtapfilter.html
/usr/share/doc/qt/qtsensors/qtapreading-members.html
/usr/share/doc/qt/qtsensors/qtapreading.html
/usr/share/doc/qt/qtsensors/qtapsensor-members.html
/usr/share/doc/qt/qtsensors/qtapsensor.html
/usr/share/doc/qt/qtsensors/qtiltfilter-members.html
/usr/share/doc/qt/qtsensors/qtiltfilter.html
/usr/share/doc/qt/qtsensors/qtiltreading-members.html
/usr/share/doc/qt/qtsensors/qtiltreading.html
/usr/share/doc/qt/qtsensors/qtiltsensor-members.html
/usr/share/doc/qt/qtsensors/qtiltsensor.html
/usr/share/doc/qt/qtsensors/qtsensorgestures-cpp.html
/usr/share/doc/qt/qtsensors/qtsensors-accelbubble-example.html
/usr/share/doc/qt/qtsensors/qtsensors-cpp.html
/usr/share/doc/qt/qtsensors/qtsensors-examples.html
/usr/share/doc/qt/qtsensors/qtsensors-grue-example.html
/usr/share/doc/qt/qtsensors/qtsensors-index.html
/usr/share/doc/qt/qtsensors/qtsensors-maze-example.html
/usr/share/doc/qt/qtsensors/qtsensors-module.html
/usr/share/doc/qt/qtsensors/qtsensors-porting.html
/usr/share/doc/qt/qtsensors/qtsensors-qmlmodule.html
/usr/share/doc/qt/qtsensors/qtsensors-qmlqtsensors-example.html
/usr/share/doc/qt/qtsensors/qtsensors-qmlsensorgestures-example.html
/usr/share/doc/qt/qtsensors/qtsensors-sensor-explorer-example.html
/usr/share/doc/qt/qtsensors/qtsensors-sensorgestures-example.html
/usr/share/doc/qt/qtsensors/qtsensors-shakeit-example.html
/usr/share/doc/qt/qtsensors/qtsensors.index
/usr/share/doc/qt/qtsensors/qtsensors.qhp
/usr/share/doc/qt/qtsensors/qtsensors.qhp.sha1
/usr/share/doc/qt/qtsensors/qtsensors.tags
/usr/share/doc/qt/qtsensors/senorfwbackend.html
/usr/share/doc/qt/qtsensors/sensorgesture-emulator-topics.html
/usr/share/doc/qt/qtsensors/sensorgesture-plugins-topics.html
/usr/share/doc/qt/qtsensors/sensors-backend-topics.html
/usr/share/doc/qt/qtsensors/images/accelbubble.png
/usr/share/doc/qt/qtsensors/images/arrow_bc.png
/usr/share/doc/qt/qtsensors/images/bgrContent.png
/usr/share/doc/qt/qtsensors/images/btn_next.png
/usr/share/doc/qt/qtsensors/images/btn_prev.png
/usr/share/doc/qt/qtsensors/images/bullet_dn.png
/usr/share/doc/qt/qtsensors/images/bullet_sq.png
/usr/share/doc/qt/qtsensors/images/home.png
/usr/share/doc/qt/qtsensors/images/ico_note.png
/usr/share/doc/qt/qtsensors/images/ico_note_attention.png
/usr/share/doc/qt/qtsensors/images/ico_out.png
/usr/share/doc/qt/qtsensors/images/logo.png
/usr/share/doc/qt/qtsensors/images/maze.png
/usr/share/doc/qt/qtsensors/images/qmlqtsensors.png
/usr/share/doc/qt/qtsensors/images/qtsensors-examples-explorer.png
/usr/share/doc/qt/qtsensors/images/qtsensors-examples-grue.png
/usr/share/doc/qt/qtsensors/images/sensorgesture-cover.png
/usr/share/doc/qt/qtsensors/images/sensorgesture-doubletap.png
/usr/share/doc/qt/qtsensors/images/sensorgesture-facedown.png
/usr/share/doc/qt/qtsensors/images/sensorgesture-faceup.png
/usr/share/doc/qt/qtsensors/images/sensorgesture-hover.png
/usr/share/doc/qt/qtsensors/images/sensorgesture-shake.png
/usr/share/doc/qt/qtsensors/images/sensorgesture-slam_1.png
/usr/share/doc/qt/qtsensors/images/sensorgesture-slam_2.png
/usr/share/doc/qt/qtsensors/images/sensorgesture-twist.png
/usr/share/doc/qt/qtsensors/images/sensorgesture-whip.png
/usr/share/doc/qt/qtsensors/images/sensorgesturecpp.png
/usr/share/doc/qt/qtsensors/images/sensors-coordinates.jpg
/usr/share/doc/qt/qtsensors/images/sensors-coordinates2.jpg
/usr/share/doc/qt/qtsensors/images/sensors-coordinates3.jpg
/usr/share/doc/qt/qtsensors/images/sensors-dynamic.png
/usr/share/doc/qt/qtsensors/images/sensors-geo-vs-raw-magnetism.jpg
/usr/share/doc/qt/qtsensors/images/sensors-orientation.jpg
/usr/share/doc/qt/qtsensors/images/sensors-overview.png
/usr/share/doc/qt/qtsensors/images/sensors-rotation-anim.gif
/usr/share/doc/qt/qtsensors/images/sensors-rotation.jpg
/usr/share/doc/qt/qtsensors/images/sensors-rotation2.jpg
/usr/share/doc/qt/qtsensors/images/sensors-rotation3.jpg
/usr/share/doc/qt/qtsensors/images/sensors-sides.jpg
/usr/share/doc/qt/qtsensors/images/sensors-sides2.jpg
/usr/share/doc/qt/qtsensors/images/sensors-static.png
/usr/share/doc/qt/qtsensors/images/shakeit.png
/usr/share/doc/qt/qtsensors/style/offline-simple.css
/usr/share/doc/qt/qtsensors/style/offline.css
/usr/share/doc/qt/qtserialbus/examples-manifest.xml
/usr/share/doc/qt/qtserialbus/qcanbus-members.html
/usr/share/doc/qt/qtserialbus/qcanbus.html
/usr/share/doc/qt/qtserialbus/qcanbusdevice-filter-members.html
/usr/share/doc/qt/qtserialbus/qcanbusdevice-filter.html
/usr/share/doc/qt/qtserialbus/qcanbusdevice-members.html
/usr/share/doc/qt/qtserialbus/qcanbusdevice.html
/usr/share/doc/qt/qtserialbus/qcanbusdeviceinfo-members.html
/usr/share/doc/qt/qtserialbus/qcanbusdeviceinfo.html
/usr/share/doc/qt/qtserialbus/qcanbusfactory-members.html
/usr/share/doc/qt/qtserialbus/qcanbusfactory.html
/usr/share/doc/qt/qtserialbus/qcanbusfactoryv2-members.html
/usr/share/doc/qt/qtserialbus/qcanbusfactoryv2.html
/usr/share/doc/qt/qtserialbus/qcanbusframe-members.html
/usr/share/doc/qt/qtserialbus/qcanbusframe-timestamp-members.html
/usr/share/doc/qt/qtserialbus/qcanbusframe-timestamp.html
/usr/share/doc/qt/qtserialbus/qcanbusframe.html
/usr/share/doc/qt/qtserialbus/qmodbusclient-members.html
/usr/share/doc/qt/qtserialbus/qmodbusclient.html
/usr/share/doc/qt/qtserialbus/qmodbusdataunit-members.html
/usr/share/doc/qt/qtserialbus/qmodbusdataunit.html
/usr/share/doc/qt/qtserialbus/qmodbusdevice-members.html
/usr/share/doc/qt/qtserialbus/qmodbusdevice.html
/usr/share/doc/qt/qtserialbus/qmodbusdeviceidentification-members.html
/usr/share/doc/qt/qtserialbus/qmodbusdeviceidentification.html
/usr/share/doc/qt/qtserialbus/qmodbusexceptionresponse-members.html
/usr/share/doc/qt/qtserialbus/qmodbusexceptionresponse.html
/usr/share/doc/qt/qtserialbus/qmodbuspdu-members.html
/usr/share/doc/qt/qtserialbus/qmodbuspdu.html
/usr/share/doc/qt/qtserialbus/qmodbusreply-members.html
/usr/share/doc/qt/qtserialbus/qmodbusreply.html
/usr/share/doc/qt/qtserialbus/qmodbusrequest-members.html
/usr/share/doc/qt/qtserialbus/qmodbusrequest.html
/usr/share/doc/qt/qtserialbus/qmodbusresponse-members.html
/usr/share/doc/qt/qtserialbus/qmodbusresponse.html
/usr/share/doc/qt/qtserialbus/qmodbusrtuserialmaster-members.html
/usr/share/doc/qt/qtserialbus/qmodbusrtuserialmaster.html
/usr/share/doc/qt/qtserialbus/qmodbusrtuserialslave-members.html
/usr/share/doc/qt/qtserialbus/qmodbusrtuserialslave.html
/usr/share/doc/qt/qtserialbus/qmodbusserver-members.html
/usr/share/doc/qt/qtserialbus/qmodbusserver.html
/usr/share/doc/qt/qtserialbus/qmodbustcpclient-members.html
/usr/share/doc/qt/qtserialbus/qmodbustcpclient.html
/usr/share/doc/qt/qtserialbus/qmodbustcpconnectionobserver-members.html
/usr/share/doc/qt/qtserialbus/qmodbustcpconnectionobserver.html
/usr/share/doc/qt/qtserialbus/qmodbustcpserver-members.html
/usr/share/doc/qt/qtserialbus/qmodbustcpserver.html
/usr/share/doc/qt/qtserialbus/qtcanbus-backends.html
/usr/share/doc/qt/qtserialbus/qtmodbus-backends.html
/usr/share/doc/qt/qtserialbus/qtserialbus-can-example.html
/usr/share/doc/qt/qtserialbus/qtserialbus-examples.html
/usr/share/doc/qt/qtserialbus/qtserialbus-index.html
/usr/share/doc/qt/qtserialbus/qtserialbus-modbus-master-example.html
/usr/share/doc/qt/qtserialbus/qtserialbus-modbus-slave-example.html
/usr/share/doc/qt/qtserialbus/qtserialbus-module.html
/usr/share/doc/qt/qtserialbus/qtserialbus-passthrucan-overview.html
/usr/share/doc/qt/qtserialbus/qtserialbus-peakcan-overview.html
/usr/share/doc/qt/qtserialbus/qtserialbus-socketcan-overview.html
/usr/share/doc/qt/qtserialbus/qtserialbus-systeccan-overview.html
/usr/share/doc/qt/qtserialbus/qtserialbus-tinycan-overview.html
/usr/share/doc/qt/qtserialbus/qtserialbus-vectorcan-overview.html
/usr/share/doc/qt/qtserialbus/qtserialbus-virtualcan-overview.html
/usr/share/doc/qt/qtserialbus/qtserialbus.index
/usr/share/doc/qt/qtserialbus/qtserialbus.qhp
/usr/share/doc/qt/qtserialbus/qtserialbus.qhp.sha1
/usr/share/doc/qt/qtserialbus/qtserialbus.tags
/usr/share/doc/qt/qtserialbus/images/arrow_bc.png
/usr/share/doc/qt/qtserialbus/images/bgrContent.png
/usr/share/doc/qt/qtserialbus/images/btn_next.png
/usr/share/doc/qt/qtserialbus/images/btn_prev.png
/usr/share/doc/qt/qtserialbus/images/bullet_dn.png
/usr/share/doc/qt/qtserialbus/images/bullet_sq.png
/usr/share/doc/qt/qtserialbus/images/can-example.png
/usr/share/doc/qt/qtserialbus/images/home.png
/usr/share/doc/qt/qtserialbus/images/ico_note.png
/usr/share/doc/qt/qtserialbus/images/ico_note_attention.png
/usr/share/doc/qt/qtserialbus/images/ico_out.png
/usr/share/doc/qt/qtserialbus/images/logo.png
/usr/share/doc/qt/qtserialbus/images/modbusmaster.png
/usr/share/doc/qt/qtserialbus/images/modbusserver.png
/usr/share/doc/qt/qtserialbus/style/offline-simple.css
/usr/share/doc/qt/qtserialbus/style/offline.css
/usr/share/doc/qt/qtserialport/examples-manifest.xml
/usr/share/doc/qt/qtserialport/qserialport-members.html
/usr/share/doc/qt/qtserialport/qserialport-obsolete.html
/usr/share/doc/qt/qtserialport/qserialport.html
/usr/share/doc/qt/qtserialport/qserialportinfo-members.html
/usr/share/doc/qt/qtserialport/qserialportinfo-obsolete.html
/usr/share/doc/qt/qtserialport/qserialportinfo.html
/usr/share/doc/qt/qtserialport/qtserialport-blockingmaster-example.html
/usr/share/doc/qt/qtserialport/qtserialport-blockingslave-example.html
/usr/share/doc/qt/qtserialport/qtserialport-cenumerator-example.html
/usr/share/doc/qt/qtserialport/qtserialport-creaderasync-example.html
/usr/share/doc/qt/qtserialport/qtserialport-creadersync-example.html
/usr/share/doc/qt/qtserialport/qtserialport-cwriterasync-example.html
/usr/share/doc/qt/qtserialport/qtserialport-cwritersync-example.html
/usr/share/doc/qt/qtserialport/qtserialport-enumerator-example.html
/usr/share/doc/qt/qtserialport/qtserialport-examples.html
/usr/share/doc/qt/qtserialport/qtserialport-index.html
/usr/share/doc/qt/qtserialport/qtserialport-module.html
/usr/share/doc/qt/qtserialport/qtserialport-terminal-example.html
/usr/share/doc/qt/qtserialport/qtserialport.index
/usr/share/doc/qt/qtserialport/qtserialport.qhp
/usr/share/doc/qt/qtserialport/qtserialport.qhp.sha1
/usr/share/doc/qt/qtserialport/images/arrow_bc.png
/usr/share/doc/qt/qtserialport/images/bgrContent.png
/usr/share/doc/qt/qtserialport/images/blockingmaster-example.png
/usr/share/doc/qt/qtserialport/images/blockingslave-example.png
/usr/share/doc/qt/qtserialport/images/btn_next.png
/usr/share/doc/qt/qtserialport/images/btn_prev.png
/usr/share/doc/qt/qtserialport/images/bullet_dn.png
/usr/share/doc/qt/qtserialport/images/bullet_sq.png
/usr/share/doc/qt/qtserialport/images/cenumerator-example.png
/usr/share/doc/qt/qtserialport/images/creaderasync-example.png
/usr/share/doc/qt/qtserialport/images/creadersync-example.png
/usr/share/doc/qt/qtserialport/images/cwriterasync-example.png
/usr/share/doc/qt/qtserialport/images/cwritersync-example.png
/usr/share/doc/qt/qtserialport/images/enumerator-example.png
/usr/share/doc/qt/qtserialport/images/home.png
/usr/share/doc/qt/qtserialport/images/ico_note.png
/usr/share/doc/qt/qtserialport/images/ico_note_attention.png
/usr/share/doc/qt/qtserialport/images/ico_out.png
/usr/share/doc/qt/qtserialport/images/logo.png
/usr/share/doc/qt/qtserialport/images/terminal-example.png
/usr/share/doc/qt/qtserialport/style/offline-simple.css
/usr/share/doc/qt/qtserialport/style/offline.css
/usr/share/doc/qt/qtspeech/examples-manifest.xml
/usr/share/doc/qt/qtspeech/qtspeech-hello-speak-example.html
/usr/share/doc/qt/qtspeech/qtspeech-index.html
/usr/share/doc/qt/qtspeech/qtspeech-module.html
/usr/share/doc/qt/qtspeech/qtspeech.index
/usr/share/doc/qt/qtspeech/qtspeech.qhp
/usr/share/doc/qt/qtspeech/qtspeech.qhp.sha1
/usr/share/doc/qt/qtspeech/qtspeech.tags
/usr/share/doc/qt/qtspeech/images/arrow_bc.png
/usr/share/doc/qt/qtspeech/images/bgrContent.png
/usr/share/doc/qt/qtspeech/images/btn_next.png
/usr/share/doc/qt/qtspeech/images/btn_prev.png
/usr/share/doc/qt/qtspeech/images/bullet_dn.png
/usr/share/doc/qt/qtspeech/images/bullet_sq.png
/usr/share/doc/qt/qtspeech/images/hellospeak-example.png
/usr/share/doc/qt/qtspeech/images/home.png
/usr/share/doc/qt/qtspeech/images/ico_note.png
/usr/share/doc/qt/qtspeech/images/ico_note_attention.png
/usr/share/doc/qt/qtspeech/images/ico_out.png
/usr/share/doc/qt/qtspeech/images/logo.png
/usr/share/doc/qt/qtspeech/style/offline-simple.css
/usr/share/doc/qt/qtspeech/style/offline.css
/usr/share/doc/qt/qtsql/database.html
/usr/share/doc/qt/qtsql/examples-manifest.xml
/usr/share/doc/qt/qtsql/qsql.html
/usr/share/doc/qt/qtsql/qsqldatabase-members.html
/usr/share/doc/qt/qtsql/qsqldatabase.html
/usr/share/doc/qt/qtsql/qsqldriver-members.html
/usr/share/doc/qt/qtsql/qsqldriver.html
/usr/share/doc/qt/qtsql/qsqldrivercreator-members.html
/usr/share/doc/qt/qtsql/qsqldrivercreator.html
/usr/share/doc/qt/qtsql/qsqldrivercreatorbase-members.html
/usr/share/doc/qt/qtsql/qsqldrivercreatorbase.html
/usr/share/doc/qt/qtsql/qsqldriverplugin-members.html
/usr/share/doc/qt/qtsql/qsqldriverplugin.html
/usr/share/doc/qt/qtsql/qsqlerror-members.html
/usr/share/doc/qt/qtsql/qsqlerror-obsolete.html
/usr/share/doc/qt/qtsql/qsqlerror.html
/usr/share/doc/qt/qtsql/qsqlfield-members.html
/usr/share/doc/qt/qtsql/qsqlfield.html
/usr/share/doc/qt/qtsql/qsqlindex-members.html
/usr/share/doc/qt/qtsql/qsqlindex.html
/usr/share/doc/qt/qtsql/qsqlquery-members.html
/usr/share/doc/qt/qtsql/qsqlquery.html
/usr/share/doc/qt/qtsql/qsqlquerymodel-members.html
/usr/share/doc/qt/qtsql/qsqlquerymodel.html
/usr/share/doc/qt/qtsql/qsqlrecord-members.html
/usr/share/doc/qt/qtsql/qsqlrecord.html
/usr/share/doc/qt/qtsql/qsqlrelation-members.html
/usr/share/doc/qt/qtsql/qsqlrelation.html
/usr/share/doc/qt/qtsql/qsqlrelationaldelegate-members.html
/usr/share/doc/qt/qtsql/qsqlrelationaldelegate.html
/usr/share/doc/qt/qtsql/qsqlrelationaltablemodel-members.html
/usr/share/doc/qt/qtsql/qsqlrelationaltablemodel.html
/usr/share/doc/qt/qtsql/qsqlresult-members.html
/usr/share/doc/qt/qtsql/qsqlresult.html
/usr/share/doc/qt/qtsql/qsqltablemodel-members.html
/usr/share/doc/qt/qtsql/qsqltablemodel.html
/usr/share/doc/qt/qtsql/qtsql-attribution-sqlite.html
/usr/share/doc/qt/qtsql/qtsql-books-example.html
/usr/share/doc/qt/qtsql/qtsql-cachedtable-example.html
/usr/share/doc/qt/qtsql/qtsql-drilldown-example.html
/usr/share/doc/qt/qtsql/qtsql-index.html
/usr/share/doc/qt/qtsql/qtsql-masterdetail-example.html
/usr/share/doc/qt/qtsql/qtsql-module.html
/usr/share/doc/qt/qtsql/qtsql-querymodel-example.html
/usr/share/doc/qt/qtsql/qtsql-relationaltablemodel-example.html
/usr/share/doc/qt/qtsql/qtsql-sqlbrowser-example.html
/usr/share/doc/qt/qtsql/qtsql-sqlwidgetmapper-example.html
/usr/share/doc/qt/qtsql/qtsql-tablemodel-example.html
/usr/share/doc/qt/qtsql/qtsql.index
/usr/share/doc/qt/qtsql/qtsql.qhp
/usr/share/doc/qt/qtsql/qtsql.qhp.sha1
/usr/share/doc/qt/qtsql/qtsql.tags
/usr/share/doc/qt/qtsql/sql-connecting.html
/usr/share/doc/qt/qtsql/sql-driver.html
/usr/share/doc/qt/qtsql/sql-forms.html
/usr/share/doc/qt/qtsql/sql-model.html
/usr/share/doc/qt/qtsql/sql-presenting.html
/usr/share/doc/qt/qtsql/sql-programming.html
/usr/share/doc/qt/qtsql/sql-sqlstatements.html
/usr/share/doc/qt/qtsql/sql-types.html
/usr/share/doc/qt/qtsql/images/arrow_bc.png
/usr/share/doc/qt/qtsql/images/bgrContent.png
/usr/share/doc/qt/qtsql/images/books-demo.png
/usr/share/doc/qt/qtsql/images/btn_next.png
/usr/share/doc/qt/qtsql/images/btn_prev.png
/usr/share/doc/qt/qtsql/images/bullet_dn.png
/usr/share/doc/qt/qtsql/images/bullet_sq.png
/usr/share/doc/qt/qtsql/images/cachedtable-example.png
/usr/share/doc/qt/qtsql/images/drilldown-example.png
/usr/share/doc/qt/qtsql/images/foreignkeys.png
/usr/share/doc/qt/qtsql/images/home.png
/usr/share/doc/qt/qtsql/images/ico_note.png
/usr/share/doc/qt/qtsql/images/ico_note_attention.png
/usr/share/doc/qt/qtsql/images/ico_out.png
/usr/share/doc/qt/qtsql/images/insertrowinmodelview.png
/usr/share/doc/qt/qtsql/images/logo.png
/usr/share/doc/qt/qtsql/images/masterdetail-example.png
/usr/share/doc/qt/qtsql/images/noforeignkeys.png
/usr/share/doc/qt/qtsql/images/qdatawidgetmapper-simple.png
/usr/share/doc/qt/qtsql/images/querymodel-example.png
/usr/share/doc/qt/qtsql/images/relationaltable.png
/usr/share/doc/qt/qtsql/images/relationaltablemodel-example.png
/usr/share/doc/qt/qtsql/images/sql-widget-mapper.png
/usr/share/doc/qt/qtsql/images/sqlbrowser-demo.png
/usr/share/doc/qt/qtsql/images/tablemodel-example.png
/usr/share/doc/qt/qtsql/images/widgetmapper-sql-mapping-table.png
/usr/share/doc/qt/qtsql/images/widgetmapper-sql-mapping.png
/usr/share/doc/qt/qtsql/style/offline-simple.css
/usr/share/doc/qt/qtsql/style/offline.css
/usr/share/doc/qt/qtsvg/examples-manifest.xml
/usr/share/doc/qt/qtsvg/qgraphicssvgitem-members.html
/usr/share/doc/qt/qtsvg/qgraphicssvgitem-obsolete.html
/usr/share/doc/qt/qtsvg/qgraphicssvgitem.html
/usr/share/doc/qt/qtsvg/qsvggenerator-members.html
/usr/share/doc/qt/qtsvg/qsvggenerator.html
/usr/share/doc/qt/qtsvg/qsvgrenderer-members.html
/usr/share/doc/qt/qtsvg/qsvgrenderer.html
/usr/share/doc/qt/qtsvg/qsvgwidget-members.html
/usr/share/doc/qt/qtsvg/qsvgwidget.html
/usr/share/doc/qt/qtsvg/qtsvg-attribution-xsvg.html
/usr/share/doc/qt/qtsvg/qtsvg-index.html
/usr/share/doc/qt/qtsvg/qtsvg-module.html
/usr/share/doc/qt/qtsvg/qtsvg-richtext-textobject-example.html
/usr/share/doc/qt/qtsvg/qtsvg-svggenerator-example.html
/usr/share/doc/qt/qtsvg/qtsvg-svgviewer-example.html
/usr/share/doc/qt/qtsvg/qtsvg.index
/usr/share/doc/qt/qtsvg/qtsvg.qhp
/usr/share/doc/qt/qtsvg/qtsvg.qhp.sha1
/usr/share/doc/qt/qtsvg/qtsvg.tags
/usr/share/doc/qt/qtsvg/svgrendering.html
/usr/share/doc/qt/qtsvg/images/arrow_bc.png
/usr/share/doc/qt/qtsvg/images/bgrContent.png
/usr/share/doc/qt/qtsvg/images/btn_next.png
/usr/share/doc/qt/qtsvg/images/btn_prev.png
/usr/share/doc/qt/qtsvg/images/bullet_dn.png
/usr/share/doc/qt/qtsvg/images/bullet_sq.png
/usr/share/doc/qt/qtsvg/images/home.png
/usr/share/doc/qt/qtsvg/images/ico_note.png
/usr/share/doc/qt/qtsvg/images/ico_note_attention.png
/usr/share/doc/qt/qtsvg/images/ico_out.png
/usr/share/doc/qt/qtsvg/images/logo.png
/usr/share/doc/qt/qtsvg/images/svggenerator-example.png
/usr/share/doc/qt/qtsvg/images/svgviewer-example.png
/usr/share/doc/qt/qtsvg/images/textobject-example.png
/usr/share/doc/qt/qtsvg/style/offline-simple.css
/usr/share/doc/qt/qtsvg/style/offline.css
/usr/share/doc/qt/qttestlib/examples-manifest.xml
/usr/share/doc/qt/qttestlib/qabstractitemmodeltester-members.html
/usr/share/doc/qt/qttestlib/qabstractitemmodeltester.html
/usr/share/doc/qt/qttestlib/qsignalspy-members.html
/usr/share/doc/qt/qttestlib/qsignalspy.html
/usr/share/doc/qt/qttestlib/qtest-obsolete.html
/usr/share/doc/qt/qttestlib/qtest-overview.html
/usr/share/doc/qt/qttestlib/qtest-qtoucheventsequence-members.html
/usr/share/doc/qt/qttestlib/qtest-qtoucheventsequence.html
/usr/share/doc/qt/qttestlib/qtest-tutorial.html
/usr/share/doc/qt/qttestlib/qtest.html
/usr/share/doc/qt/qttestlib/qtesteventlist-members.html
/usr/share/doc/qt/qttestlib/qtesteventlist.html
/usr/share/doc/qt/qttestlib/qttest-index.html
/usr/share/doc/qt/qttestlib/qttest-module.html
/usr/share/doc/qt/qttestlib/qttestlib-attribution-cycle.html
/usr/share/doc/qt/qttestlib/qttestlib-attribution-linuxperf.html
/usr/share/doc/qt/qttestlib/qttestlib-attribution-valgrind.html
/usr/share/doc/qt/qttestlib/qttestlib-tutorial1-example.html
/usr/share/doc/qt/qttestlib/qttestlib-tutorial2-example.html
/usr/share/doc/qt/qttestlib/qttestlib-tutorial3-example.html
/usr/share/doc/qt/qttestlib/qttestlib-tutorial4-example.html
/usr/share/doc/qt/qttestlib/qttestlib-tutorial5-example.html
/usr/share/doc/qt/qttestlib/qttestlib-tutorial6.html
/usr/share/doc/qt/qttestlib/qttestlib.index
/usr/share/doc/qt/qttestlib/qttestlib.qhp
/usr/share/doc/qt/qttestlib/qttestlib.qhp.sha1
/usr/share/doc/qt/qttestlib/qttestlib.tags
/usr/share/doc/qt/qttestlib/images/arrow_bc.png
/usr/share/doc/qt/qttestlib/images/bgrContent.png
/usr/share/doc/qt/qttestlib/images/btn_next.png
/usr/share/doc/qt/qttestlib/images/btn_prev.png
/usr/share/doc/qt/qttestlib/images/bullet_dn.png
/usr/share/doc/qt/qttestlib/images/bullet_sq.png
/usr/share/doc/qt/qttestlib/images/home.png
/usr/share/doc/qt/qttestlib/images/ico_note.png
/usr/share/doc/qt/qttestlib/images/ico_note_attention.png
/usr/share/doc/qt/qttestlib/images/ico_out.png
/usr/share/doc/qt/qttestlib/images/logo.png
/usr/share/doc/qt/qttestlib/style/offline-simple.css
/usr/share/doc/qt/qttestlib/style/offline.css
/usr/share/doc/qt/qtuitools/examples-manifest.xml
/usr/share/doc/qt/qtuitools/examples-qtuitools.html
/usr/share/doc/qt/qtuitools/qtuitools-index.html
/usr/share/doc/qt/qtuitools/qtuitools-module.html
/usr/share/doc/qt/qtuitools/qtuitools-multipleinheritance-example.html
/usr/share/doc/qt/qtuitools/qtuitools-textfinder-example.html
/usr/share/doc/qt/qtuitools/qtuitools.index
/usr/share/doc/qt/qtuitools/qtuitools.qhp
/usr/share/doc/qt/qtuitools/qtuitools.qhp.sha1
/usr/share/doc/qt/qtuitools/quiloader-members.html
/usr/share/doc/qt/qtuitools/quiloader.html
/usr/share/doc/qt/qtuitools/images/arrow_bc.png
/usr/share/doc/qt/qtuitools/images/bgrContent.png
/usr/share/doc/qt/qtuitools/images/btn_next.png
/usr/share/doc/qt/qtuitools/images/btn_prev.png
/usr/share/doc/qt/qtuitools/images/bullet_dn.png
/usr/share/doc/qt/qtuitools/images/bullet_sq.png
/usr/share/doc/qt/qtuitools/images/home.png
/usr/share/doc/qt/qtuitools/images/ico_note.png
/usr/share/doc/qt/qtuitools/images/ico_note_attention.png
/usr/share/doc/qt/qtuitools/images/ico_out.png
/usr/share/doc/qt/qtuitools/images/logo.png
/usr/share/doc/qt/qtuitools/images/multipleinheritance-example.png
/usr/share/doc/qt/qtuitools/images/textfinder-example-find.png
/usr/share/doc/qt/qtuitools/images/textfinder-example-find2.png
/usr/share/doc/qt/qtuitools/images/textfinder-example-userinterface.png
/usr/share/doc/qt/qtuitools/images/uitools-examples.png
/usr/share/doc/qt/qtuitools/style/offline-simple.css
/usr/share/doc/qt/qtuitools/style/offline.css
/usr/share/doc/qt/qtvirtualkeyboard/examples-manifest.xml
/usr/share/doc/qt/qtvirtualkeyboard/handwriting.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-backspacekey-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-backspacekey.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-basekey-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-basekey.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-changelanguagekey-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-changelanguagekey.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-enterkey-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-enterkey.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-enterkeyaction-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-enterkeyaction.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-fillerkey-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-fillerkey.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-handwritinginputpanel-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-handwritinginputpanel.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-handwritingmodekey-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-handwritingmodekey.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-hidekeyboardkey-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-hidekeyboardkey.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputcontext-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputcontext-obsolete.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputcontext.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputengine-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputengine.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputmethod-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputmethod.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputmodekey-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputmodekey.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputpanel-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-inputpanel.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-key-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-key.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-keyboardcolumn-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-keyboardcolumn.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-keyboardlayout-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-keyboardlayout.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-keyboardlayoutloader-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-keyboardlayoutloader.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-keyboardrow-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-keyboardrow.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-modekey-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-modekey.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-numberkey-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-numberkey.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-selectionlistmodel-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-selectionlistmodel.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-settings-virtualkeyboardsettings-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-settings-virtualkeyboardsettings.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-shifthandler-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-shifthandler.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-shiftkey-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-shiftkey.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-spacekey-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-spacekey.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-keyboardstyle-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-keyboardstyle.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-keyicon-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-keyicon.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-keypanel-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-keypanel.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-selectionlistitem-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-selectionlistitem.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-tracecanvas-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-tracecanvas.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-traceinputkeypanel-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-styles-traceinputkeypanel.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-symbolmodekey-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-symbolmodekey.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-trace-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-trace.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-traceinputarea-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-traceinputarea.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-traceinputkey-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qml-qtquick-virtualkeyboard-traceinputkey.html
/usr/share/doc/qt/qtvirtualkeyboard/qtquick-virtualkeyboard-qmlmodule.html
/usr/share/doc/qt/qtvirtualkeyboard/qtquick-virtualkeyboard-settings-qmlmodule.html
/usr/share/doc/qt/qtvirtualkeyboard/qtquick-virtualkeyboard-styles-qmlmodule.html
/usr/share/doc/qt/qtvirtualkeyboard/qtvirtualkeyboard-attribution-lipitk.html
/usr/share/doc/qt/qtvirtualkeyboard/qtvirtualkeyboard-attribution-openwnn.html
/usr/share/doc/qt/qtvirtualkeyboard/qtvirtualkeyboard-attribution-pinyin.html
/usr/share/doc/qt/qtvirtualkeyboard/qtvirtualkeyboard-attribution-tcime.html
/usr/share/doc/qt/qtvirtualkeyboard/qtvirtualkeyboard-basic-example.html
/usr/share/doc/qt/qtvirtualkeyboard/qtvirtualkeyboard-build.html
/usr/share/doc/qt/qtvirtualkeyboard/qtvirtualkeyboard-deployment-guide.html
/usr/share/doc/qt/qtvirtualkeyboard/qtvirtualkeyboard-examples.html
/usr/share/doc/qt/qtvirtualkeyboard/qtvirtualkeyboard-index.html
/usr/share/doc/qt/qtvirtualkeyboard/qtvirtualkeyboard-layouts.html
/usr/share/doc/qt/qtvirtualkeyboard/qtvirtualkeyboard-module.html
/usr/share/doc/qt/qtvirtualkeyboard/qtvirtualkeyboard-user-guide.html
/usr/share/doc/qt/qtvirtualkeyboard/qtvirtualkeyboard.index
/usr/share/doc/qt/qtvirtualkeyboard/qtvirtualkeyboard.qhp
/usr/share/doc/qt/qtvirtualkeyboard/qtvirtualkeyboard.qhp.sha1
/usr/share/doc/qt/qtvirtualkeyboard/qvirtualkeyboardabstractinputmethod-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qvirtualkeyboardabstractinputmethod.html
/usr/share/doc/qt/qtvirtualkeyboard/qvirtualkeyboardextensionplugin-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qvirtualkeyboardextensionplugin.html
/usr/share/doc/qt/qtvirtualkeyboard/qvirtualkeyboardinputcontext-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qvirtualkeyboardinputcontext-obsolete.html
/usr/share/doc/qt/qtvirtualkeyboard/qvirtualkeyboardinputcontext.html
/usr/share/doc/qt/qtvirtualkeyboard/qvirtualkeyboardinputengine-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qvirtualkeyboardinputengine.html
/usr/share/doc/qt/qtvirtualkeyboard/qvirtualkeyboardselectionlistmodel-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qvirtualkeyboardselectionlistmodel.html
/usr/share/doc/qt/qtvirtualkeyboard/qvirtualkeyboardtrace-members.html
/usr/share/doc/qt/qtvirtualkeyboard/qvirtualkeyboardtrace.html
/usr/share/doc/qt/qtvirtualkeyboard/technical-guide.html
/usr/share/doc/qt/qtvirtualkeyboard/images/arrow_bc.png
/usr/share/doc/qt/qtvirtualkeyboard/images/basic-example.png
/usr/share/doc/qt/qtvirtualkeyboard/images/bgrContent.png
/usr/share/doc/qt/qtvirtualkeyboard/images/btn_next.png
/usr/share/doc/qt/qtvirtualkeyboard/images/btn_prev.png
/usr/share/doc/qt/qtvirtualkeyboard/images/bullet_dn.png
/usr/share/doc/qt/qtvirtualkeyboard/images/bullet_sq.png
/usr/share/doc/qt/qtvirtualkeyboard/images/gesture-double-left.png
/usr/share/doc/qt/qtvirtualkeyboard/images/gesture-double-up.png
/usr/share/doc/qt/qtvirtualkeyboard/images/gesture-single-down-left.png
/usr/share/doc/qt/qtvirtualkeyboard/images/gesture-single-left.png
/usr/share/doc/qt/qtvirtualkeyboard/images/gesture-single-right.png
/usr/share/doc/qt/qtvirtualkeyboard/images/gesture-single-up.png
/usr/share/doc/qt/qtvirtualkeyboard/images/handwriting-mode-icon.png
/usr/share/doc/qt/qtvirtualkeyboard/images/handwriting.gif
/usr/share/doc/qt/qtvirtualkeyboard/images/home.png
/usr/share/doc/qt/qtvirtualkeyboard/images/ico_note.png
/usr/share/doc/qt/qtvirtualkeyboard/images/ico_note_attention.png
/usr/share/doc/qt/qtvirtualkeyboard/images/ico_out.png
/usr/share/doc/qt/qtvirtualkeyboard/images/language-icon.png
/usr/share/doc/qt/qtvirtualkeyboard/images/logo.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-ar_AR.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-bg_BG-latin.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-bg_BG.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-cs_CZ.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-da_DK.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-de_DE.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-el_GR-latin.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-el_GR.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-en_GB.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-en_US.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-es_ES.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-es_MX.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-et_EE.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-fa_FA.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-fi_FI.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-fr_CA.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-fr_FR.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-he_IL-latin.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-he_IL.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-hi_IN.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-hr_HR.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-hu_HU.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-id_ID.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-it_IT.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-ja_JP-full-width.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-ja_JP-hiragana.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-ja_JP-katakana.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-ja_JP-latin.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-ko_KR.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-ms_MY.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-nb_NO.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-nl_NL.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-pl_PL.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-pt_BR.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-pt_PT.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-ro_RO.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-ru_RU.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-sk_SK.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-sl_SI.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-sq_AL.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-sr_SP-latin.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-sr_SP.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-sv_SE.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-th_TH.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-tr_TR.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-uk_UA.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-vi_VN.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-zh_CN.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-zh_TW-cangjie.png
/usr/share/doc/qt/qtvirtualkeyboard/images/qtvirtualkeyboard-layout-zh_TW-zhuyin.png
/usr/share/doc/qt/qtvirtualkeyboard/style/offline-simple.css
/usr/share/doc/qt/qtvirtualkeyboard/style/offline.css
/usr/share/doc/qt/qtwaylandcompositor/examples-manifest.xml
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-iviapplication-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-iviapplication.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-ivisurface-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-ivisurface.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-shellsurface-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-shellsurface.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-shellsurfaceitem-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-shellsurfaceitem.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-waylandclient-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-waylandclient.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-waylandcompositor-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-waylandcompositor.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-waylandhardwarelayer-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-waylandhardwarelayer.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-waylandoutput-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-waylandoutput.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-waylandquickitem-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-waylandquickitem.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-waylandseat-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-waylandseat.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-waylandsurface-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-waylandsurface-obsolete.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-waylandsurface.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-waylandview-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-waylandview.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-wlscaler-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-wlscaler.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-wlshell-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-wlshell.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-wlshellsurface-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-wlshellsurface.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-xdgdecorationmanagerv1-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-xdgdecorationmanagerv1.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-xdgpopup-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-xdgpopup.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-xdgpopupv5-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-xdgpopupv5.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-xdgpopupv6-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-xdgpopupv6.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-xdgshell-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-xdgshell.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-xdgshellv5-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-xdgshellv5.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-xdgshellv6-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-xdgshellv6.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-xdgsurface-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-xdgsurface.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-xdgsurfacev5-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-xdgsurfacev5.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-xdgsurfacev6-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-xdgsurfacev6.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-xdgtoplevel-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-xdgtoplevel.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-xdgtoplevelv6-members.html
/usr/share/doc/qt/qtwaylandcompositor/qml-qtwayland-compositor-xdgtoplevelv6.html
/usr/share/doc/qt/qtwaylandcompositor/qtwayland-compositor-qmlmodule.html
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-eglstream-controller.html
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-fullscreen-protocol.html
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-ivi-extension-protocol.html
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-linux-dmabuf-unstable-v1.html
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-protocol.html
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-scaler-protocol.html
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-txt-input-unstable.html
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-viewporter-protocol.html
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-xdg-decoration-protocol.html
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-xdg-output-protocol.html
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor-attribution-wayland-xdg-shell-protocol.html
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor-examples.html
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor-index.html
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor-ivi-compositor-example.html
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor-minimal-qml-example.html
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor-module.html
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor-multi-output-example.html
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor-multi-screen-example.html
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor-overview-compositor-example.html
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor-pure-qml-example.html
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor-qwindow-compositor-example.html
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor-server-side-decoration-example.html
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor-spanning-screens-example.html
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor.index
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor.qhp
/usr/share/doc/qt/qtwaylandcompositor/qtwaylandcompositor.qhp.sha1
/usr/share/doc/qt/qtwaylandcompositor/qwaylandbufferref-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandbufferref.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandclient-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandclient.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandcompositor-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandcompositor.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandiviapplication-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandiviapplication.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandivisurface-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandivisurface.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandkeyboard-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandkeyboard.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandoutput-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandoutput.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandoutputmode-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandoutputmode.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandpointer-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandpointer.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandquickitem-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandquickitem.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandquickshellsurfaceitem-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandquickshellsurfaceitem.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandseat-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandseat.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandshellsurface-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandshellsurface.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandsurface-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandsurface-obsolete.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandsurface.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandsurfacegrabber-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandsurfacegrabber.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandtouch-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandtouch.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandview-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandview.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandviewporter-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandviewporter.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandwlscaler-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandwlscaler.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandwlshell-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandwlshell.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandwlshellsurface-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandwlshellsurface.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandxdgdecorationmanagerv1-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandxdgdecorationmanagerv1.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandxdgpopup-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandxdgpopup.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandxdgpopupv5-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandxdgpopupv5.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandxdgpopupv6-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandxdgpopupv6.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandxdgshell-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandxdgshell.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandxdgshellv5-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandxdgshellv5.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandxdgshellv6-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandxdgshellv6.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandxdgsurface-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandxdgsurface.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandxdgsurfacev5-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandxdgsurfacev5.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandxdgsurfacev6-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandxdgsurfacev6.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandxdgtoplevel-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandxdgtoplevel.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandxdgtoplevelv6-members.html
/usr/share/doc/qt/qtwaylandcompositor/qwaylandxdgtoplevelv6.html
/usr/share/doc/qt/qtwaylandcompositor/images/arrow_bc.png
/usr/share/doc/qt/qtwaylandcompositor/images/bgrContent.png
/usr/share/doc/qt/qtwaylandcompositor/images/btn_next.png
/usr/share/doc/qt/qtwaylandcompositor/images/btn_prev.png
/usr/share/doc/qt/qtwaylandcompositor/images/bullet_dn.png
/usr/share/doc/qt/qtwaylandcompositor/images/bullet_sq.png
/usr/share/doc/qt/qtwaylandcompositor/images/home.png
/usr/share/doc/qt/qtwaylandcompositor/images/ico_note.png
/usr/share/doc/qt/qtwaylandcompositor/images/ico_note_attention.png
/usr/share/doc/qt/qtwaylandcompositor/images/ico_out.png
/usr/share/doc/qt/qtwaylandcompositor/images/logo.png
/usr/share/doc/qt/qtwaylandcompositor/style/offline-simple.css
/usr/share/doc/qt/qtwaylandcompositor/style/offline.css
/usr/share/doc/qt/qtwebchannel/examples-manifest.xml
/usr/share/doc/qt/qtwebchannel/qml-qtwebchannel-webchannel-members.html
/usr/share/doc/qt/qtwebchannel/qml-qtwebchannel-webchannel.html
/usr/share/doc/qt/qtwebchannel/qtwebchannel-chatclient-html-example.html
/usr/share/doc/qt/qtwebchannel/qtwebchannel-chatclient-qml-example.html
/usr/share/doc/qt/qtwebchannel/qtwebchannel-chatserver-cpp-example.html
/usr/share/doc/qt/qtwebchannel/qtwebchannel-examples.html
/usr/share/doc/qt/qtwebchannel/qtwebchannel-index.html
/usr/share/doc/qt/qtwebchannel/qtwebchannel-javascript.html
/usr/share/doc/qt/qtwebchannel/qtwebchannel-module.html
/usr/share/doc/qt/qtwebchannel/qtwebchannel-qmlmodule.html
/usr/share/doc/qt/qtwebchannel/qtwebchannel-standalone-example.html
/usr/share/doc/qt/qtwebchannel/qtwebchannel.index
/usr/share/doc/qt/qtwebchannel/qtwebchannel.qhp
/usr/share/doc/qt/qtwebchannel/qtwebchannel.qhp.sha1
/usr/share/doc/qt/qtwebchannel/qtwebchannel.tags
/usr/share/doc/qt/qtwebchannel/qwebchannel-members.html
/usr/share/doc/qt/qtwebchannel/qwebchannel.html
/usr/share/doc/qt/qtwebchannel/qwebchannelabstracttransport-members.html
/usr/share/doc/qt/qtwebchannel/qwebchannelabstracttransport.html
/usr/share/doc/qt/qtwebchannel/images/arrow_bc.png
/usr/share/doc/qt/qtwebchannel/images/bgrContent.png
/usr/share/doc/qt/qtwebchannel/images/btn_next.png
/usr/share/doc/qt/qtwebchannel/images/btn_prev.png
/usr/share/doc/qt/qtwebchannel/images/bullet_dn.png
/usr/share/doc/qt/qtwebchannel/images/bullet_sq.png
/usr/share/doc/qt/qtwebchannel/images/chatclient-html.png
/usr/share/doc/qt/qtwebchannel/images/chatclient-qml.png
/usr/share/doc/qt/qtwebchannel/images/chatserver-cpp.png
/usr/share/doc/qt/qtwebchannel/images/home.png
/usr/share/doc/qt/qtwebchannel/images/ico_note.png
/usr/share/doc/qt/qtwebchannel/images/ico_note_attention.png
/usr/share/doc/qt/qtwebchannel/images/ico_out.png
/usr/share/doc/qt/qtwebchannel/images/logo.png
/usr/share/doc/qt/qtwebchannel/images/standalone-screenshot.png
/usr/share/doc/qt/qtwebchannel/style/offline-simple.css
/usr/share/doc/qt/qtwebchannel/style/offline.css
/usr/share/doc/qt/qtwebengine/examples-manifest.xml
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-authenticationdialogrequest-members.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-authenticationdialogrequest.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-colordialogrequest-members.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-colordialogrequest.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-contextmenurequest-members.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-contextmenurequest.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-filedialogrequest-members.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-filedialogrequest.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-formvalidationmessagerequest-members.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-formvalidationmessagerequest.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-fullscreenrequest-members.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-fullscreenrequest.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-javascriptdialogrequest-members.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-javascriptdialogrequest.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-quotarequest-members.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-quotarequest.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-registerprotocolhandlerrequest-members.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-registerprotocolhandlerrequest.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webengine-members.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webengine.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webengineaction-members.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webengineaction.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webenginecertificateerror-members.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webenginecertificateerror.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webengineclientcertificateoption-members.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webengineclientcertificateoption.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webengineclientcertificateselection-members.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webengineclientcertificateselection.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webenginedownloaditem-members.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webenginedownloaditem-obsolete.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webenginedownloaditem.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webenginehistory-members.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webenginehistory.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webenginehistorylistmodel-members.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webenginehistorylistmodel.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webengineloadrequest-members.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webengineloadrequest.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webenginenavigationrequest-members.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webenginenavigationrequest.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webenginenewviewrequest-members.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webenginenewviewrequest.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webengineprofile-members.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webengineprofile.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webenginescript-members.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webenginescript.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webenginesettings-members.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webenginesettings.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webengineview-members.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webengineview-obsolete.html
/usr/share/doc/qt/qtwebengine/qml-qtwebengine-webengineview.html
/usr/share/doc/qt/qtwebengine/qquickwebengineprofile-members.html
/usr/share/doc/qt/qtwebengine/qquickwebengineprofile-obsolete.html
/usr/share/doc/qt/qtwebengine/qquickwebengineprofile.html
/usr/share/doc/qt/qtwebengine/qquickwebenginescript-members.html
/usr/share/doc/qt/qtwebengine/qquickwebenginescript.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-abseil.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-alliance-for-open-media-video-codec.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-almost-native-graphics-layer-engine.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-android-explicit-synchronization.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-arcore-sdk.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-axe-core-accessibility-audit.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-blackmagic-decklink-sdk-mac.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-boringssl.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-breakpad-an-open-source-multi-platform-crash-reporting-system.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-brotli.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-bspatch.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-chrome-custom-tabs-example-and-usage.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-chromium-global.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-chromium-os-system-api.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-cocoa-extension-code-from-camino.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-compact-encoding-detection.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-crashpad.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-crc32c.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-d3.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-darwin.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-david-m-gay-s-floating-point-routines.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-dawn.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-dom-distiller-js.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-dynamic-annotations.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-enum34.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-expat-xml-parser.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-fdlibm.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-feed.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-ffmpeg.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-fiat-crypto-synthesizing-correct-by-construction-code-for-cryptographic-primitives.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-fips181.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-flac.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-flatbuffers.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-flot-javascript-jquery-library-for-creating-graphs.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-fontconfig.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-freetype.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-gestures.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-gifplayer-animated-gif-library.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-google-fork-of-khronos-reference-front-end-for-glsl-and-essl.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-google-glog-s-symbolization-library.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-google-ink.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-google-jstemplate.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-gvr-android-sdk.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-gvr-keyboard.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-harfbuzz-ng.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-headers-for-the-windows-10-webauthn-api-webauthn-dll.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-hunspell.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-iaccessible2-com-interfaces-for-accessibility.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-iccjpeg.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-icu.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-inspector-protocol.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-isimpledom-com-interfaces-for-accessibility.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-jinja2-python-template-engine.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-jsoncpp.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-khronos-header-files.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-leveldb-a-fast-persistent-key-value-store.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-libaddressinput.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-libcxx-pretty-printers.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-libevdev.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-libevent.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-libjingle-xmpp-and-xmllite-libraries.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-libjpeg-turbo.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-libjpeg.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-libpng.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-libprotobuf-mutator.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-libsecret.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-libsrtp.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-libudev.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-libusbx.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-libvpx.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-libxml.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-libxslt.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-libyuv.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-linux-syscall-support.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-lzma-sdk.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-mach-override.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-material-design-icons.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-mesa-headers.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-metrics-protos.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-minigbm.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-modp-base64-decoder.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-netscape-portable-runtime-nspr.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-network-security-services-nss.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-nmoinvaz-minizip.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-nvidia-control-x-extension-library.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-nvidia-management-library.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-oculus-sdk-for-windows.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-openh264.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-openmax-dl.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-openvr-sdk.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-opus.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-ots-opentype-sanitizer.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-paul-hsieh-s-superfasthash.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-pdfium.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-perfetto.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-ply-python-lex-yacc.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-protocol-buffers.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-pyjson5.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-quick-color-management-system.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-re2-an-efficient-principled-regular-expression-library.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-recurrent-neural-network-for-audio-noise-reduction.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-sfntly.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-shaderc.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-simplejson.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-skia.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-smhasher.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-snappy-a-fast-compressor-decompressor.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-spir-v-headers.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-spir-v-tools.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-sqlite.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-strongtalk.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-sudden-motion-sensor-library.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-swiftshader.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-tcmalloc.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-test-fonts.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-the-chromium-project.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-the-usb-id-repository.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-tlslite.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-unrar-source-for-decompressing-rar-and-other-files.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-uri-template-parser.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-url-parse.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-usrsctp.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-v4l-utils.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-v8-javascript-engine.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-valgrind.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-wds.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-web-animations-js.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-webkit.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-webm-container-parser-and-writer.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-webp-image-encoder-decoder.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-webrtc.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-windows-template-library-wtl.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-woff2.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-xdg-mime.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-xdg-user-dirs.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-xdg-utils.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-yara.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-yasm.html
/usr/share/doc/qt/qtwebengine/qtwebengine-3rdparty-zlib.html
/usr/share/doc/qt/qtwebengine/qtwebengine-attribution-cookiebrowser-tango.html
/usr/share/doc/qt/qtwebengine/qtwebengine-attribution-markdowneditor-markdowncss.html
/usr/share/doc/qt/qtwebengine/qtwebengine-attribution-markdowneditor-marked.html
/usr/share/doc/qt/qtwebengine/qtwebengine-attribution-quicknanobrowser-tango.html
/usr/share/doc/qt/qtwebengine/qtwebengine-attribution-recipebrowser-markdowncss.html
/usr/share/doc/qt/qtwebengine/qtwebengine-attribution-recipebrowser-marked.html
/usr/share/doc/qt/qtwebengine/qtwebengine-attribution-simplebrowser-tango.html
/usr/share/doc/qt/qtwebengine/qtwebengine-attribution-stylesheetbrowser-tango.html
/usr/share/doc/qt/qtwebengine/qtwebengine-debugging.html
/usr/share/doc/qt/qtwebengine/qtwebengine-deploying.html
/usr/share/doc/qt/qtwebengine/qtwebengine-features.html
/usr/share/doc/qt/qtwebengine/qtwebengine-index.html
/usr/share/doc/qt/qtwebengine/qtwebengine-licensing.html
/usr/share/doc/qt/qtwebengine/qtwebengine-module.html
/usr/share/doc/qt/qtwebengine/qtwebengine-modules.html
/usr/share/doc/qt/qtwebengine/qtwebengine-overview.html
/usr/share/doc/qt/qtwebengine/qtwebengine-platform-notes.html
/usr/share/doc/qt/qtwebengine/qtwebengine-qmlmodule.html
/usr/share/doc/qt/qtwebengine/qtwebengine-webengine-customdialogs-example.html
/usr/share/doc/qt/qtwebengine/qtwebengine-webengine-minimal-example.html
/usr/share/doc/qt/qtwebengine/qtwebengine-webengine-quicknanobrowser-example.html
/usr/share/doc/qt/qtwebengine/qtwebengine-webengine-recipebrowser-example.html
/usr/share/doc/qt/qtwebengine/qtwebengine-webengine-webengineaction-example.html
/usr/share/doc/qt/qtwebengine/qtwebengine-webenginewidgets-contentmanipulation-example.html
/usr/share/doc/qt/qtwebengine/qtwebengine-webenginewidgets-cookiebrowser-example.html
/usr/share/doc/qt/qtwebengine/qtwebengine-webenginewidgets-html2pdf-example.html
/usr/share/doc/qt/qtwebengine/qtwebengine-webenginewidgets-maps-example.html
/usr/share/doc/qt/qtwebengine/qtwebengine-webenginewidgets-markdowneditor-example.html
/usr/share/doc/qt/qtwebengine/qtwebengine-webenginewidgets-minimal-example.html
/usr/share/doc/qt/qtwebengine/qtwebengine-webenginewidgets-notifications-example.html
/usr/share/doc/qt/qtwebengine/qtwebengine-webenginewidgets-printme-example.html
/usr/share/doc/qt/qtwebengine/qtwebengine-webenginewidgets-simplebrowser-example.html
/usr/share/doc/qt/qtwebengine/qtwebengine-webenginewidgets-spellchecker-example.html
/usr/share/doc/qt/qtwebengine/qtwebengine-webenginewidgets-stylesheetbrowser-example.html
/usr/share/doc/qt/qtwebengine/qtwebengine-webenginewidgets-videoplayer-example.html
/usr/share/doc/qt/qtwebengine/qtwebengine-webenginewidgets-webui-example.html
/usr/share/doc/qt/qtwebengine/qtwebengine.html
/usr/share/doc/qt/qtwebengine/qtwebengine.index
/usr/share/doc/qt/qtwebengine/qtwebengine.qhp
/usr/share/doc/qt/qtwebengine/qtwebengine.qhp.sha1
/usr/share/doc/qt/qtwebengine/qtwebengine.tags
/usr/share/doc/qt/qtwebengine/qtwebenginecore-index.html
/usr/share/doc/qt/qtwebengine/qtwebenginecore-module.html
/usr/share/doc/qt/qtwebengine/qtwebenginewidgets-index.html
/usr/share/doc/qt/qtwebengine/qtwebenginewidgets-module.html
/usr/share/doc/qt/qtwebengine/qtwebenginewidgets-qtwebkitportingguide.html
/usr/share/doc/qt/qtwebengine/qwebenginecertificateerror-members.html
/usr/share/doc/qt/qtwebengine/qwebenginecertificateerror.html
/usr/share/doc/qt/qtwebengine/qwebengineclientcertificateselection-members.html
/usr/share/doc/qt/qtwebengine/qwebengineclientcertificateselection.html
/usr/share/doc/qt/qtwebengine/qwebengineclientcertificatestore-members.html
/usr/share/doc/qt/qtwebengine/qwebengineclientcertificatestore.html
/usr/share/doc/qt/qtwebengine/qwebenginecontextmenudata-members.html
/usr/share/doc/qt/qtwebengine/qwebenginecontextmenudata.html
/usr/share/doc/qt/qtwebengine/qwebenginecookiestore-filterrequest-members.html
/usr/share/doc/qt/qtwebengine/qwebenginecookiestore-filterrequest.html
/usr/share/doc/qt/qtwebengine/qwebenginecookiestore-members.html
/usr/share/doc/qt/qtwebengine/qwebenginecookiestore.html
/usr/share/doc/qt/qtwebengine/qwebenginedownloaditem-members.html
/usr/share/doc/qt/qtwebengine/qwebenginedownloaditem-obsolete.html
/usr/share/doc/qt/qtwebengine/qwebenginedownloaditem.html
/usr/share/doc/qt/qtwebengine/qwebenginefullscreenrequest-members.html
/usr/share/doc/qt/qtwebengine/qwebenginefullscreenrequest.html
/usr/share/doc/qt/qtwebengine/qwebenginehistory-members.html
/usr/share/doc/qt/qtwebengine/qwebenginehistory.html
/usr/share/doc/qt/qtwebengine/qwebenginehistoryitem-members.html
/usr/share/doc/qt/qtwebengine/qwebenginehistoryitem.html
/usr/share/doc/qt/qtwebengine/qwebenginehttprequest-members.html
/usr/share/doc/qt/qtwebengine/qwebenginehttprequest.html
/usr/share/doc/qt/qtwebengine/qwebenginenotification-members.html
/usr/share/doc/qt/qtwebengine/qwebenginenotification.html
/usr/share/doc/qt/qtwebengine/qwebenginepage-members.html
/usr/share/doc/qt/qtwebengine/qwebenginepage.html
/usr/share/doc/qt/qtwebengine/qwebengineprofile-members.html
/usr/share/doc/qt/qtwebengine/qwebengineprofile-obsolete.html
/usr/share/doc/qt/qtwebengine/qwebengineprofile.html
/usr/share/doc/qt/qtwebengine/qwebenginequotarequest-members.html
/usr/share/doc/qt/qtwebengine/qwebenginequotarequest.html
/usr/share/doc/qt/qtwebengine/qwebengineregisterprotocolhandlerrequest-members.html
/usr/share/doc/qt/qtwebengine/qwebengineregisterprotocolhandlerrequest.html
/usr/share/doc/qt/qtwebengine/qwebenginescript-members.html
/usr/share/doc/qt/qtwebengine/qwebenginescript.html
/usr/share/doc/qt/qtwebengine/qwebenginescriptcollection-members.html
/usr/share/doc/qt/qtwebengine/qwebenginescriptcollection.html
/usr/share/doc/qt/qtwebengine/qwebenginesettings-members.html
/usr/share/doc/qt/qtwebengine/qwebenginesettings-obsolete.html
/usr/share/doc/qt/qtwebengine/qwebenginesettings.html
/usr/share/doc/qt/qtwebengine/qwebengineurlrequestinfo-members.html
/usr/share/doc/qt/qtwebengine/qwebengineurlrequestinfo.html
/usr/share/doc/qt/qtwebengine/qwebengineurlrequestinterceptor-members.html
/usr/share/doc/qt/qtwebengine/qwebengineurlrequestinterceptor.html
/usr/share/doc/qt/qtwebengine/qwebengineurlrequestjob-members.html
/usr/share/doc/qt/qtwebengine/qwebengineurlrequestjob.html
/usr/share/doc/qt/qtwebengine/qwebengineurlscheme-members.html
/usr/share/doc/qt/qtwebengine/qwebengineurlscheme.html
/usr/share/doc/qt/qtwebengine/qwebengineurlschemehandler-members.html
/usr/share/doc/qt/qtwebengine/qwebengineurlschemehandler.html
/usr/share/doc/qt/qtwebengine/qwebengineview-members.html
/usr/share/doc/qt/qtwebengine/qwebengineview.html
/usr/share/doc/qt/qtwebengine/webengine-examples.html
/usr/share/doc/qt/qtwebengine/webengine-widgetexamples.html
/usr/share/doc/qt/qtwebengine/images/arrow_bc.png
/usr/share/doc/qt/qtwebengine/images/bgrContent.png
/usr/share/doc/qt/qtwebengine/images/btn_next.png
/usr/share/doc/qt/qtwebengine/images/btn_prev.png
/usr/share/doc/qt/qtwebengine/images/bullet_dn.png
/usr/share/doc/qt/qtwebengine/images/bullet_sq.png
/usr/share/doc/qt/qtwebengine/images/contentmanipulation-example.png
/usr/share/doc/qt/qtwebengine/images/cookiebrowser.png
/usr/share/doc/qt/qtwebengine/images/customdialogs-auth1.png
/usr/share/doc/qt/qtwebengine/images/customdialogs-auth2.png
/usr/share/doc/qt/qtwebengine/images/customdialogs-color1.png
/usr/share/doc/qt/qtwebengine/images/customdialogs-color2.png
/usr/share/doc/qt/qtwebengine/images/customdialogs-file1.png
/usr/share/doc/qt/qtwebengine/images/customdialogs-file2.png
/usr/share/doc/qt/qtwebengine/images/customdialogs-menu.png
/usr/share/doc/qt/qtwebengine/images/customdialogs-prompt1.png
/usr/share/doc/qt/qtwebengine/images/customdialogs-prompt2.png
/usr/share/doc/qt/qtwebengine/images/customdialogs.png
/usr/share/doc/qt/qtwebengine/images/home.png
/usr/share/doc/qt/qtwebengine/images/html2pdf-example.png
/usr/share/doc/qt/qtwebengine/images/ico_note.png
/usr/share/doc/qt/qtwebengine/images/ico_note_attention.png
/usr/share/doc/qt/qtwebengine/images/ico_out.png
/usr/share/doc/qt/qtwebengine/images/logo.png
/usr/share/doc/qt/qtwebengine/images/maps-example.png
/usr/share/doc/qt/qtwebengine/images/markdowneditor-example.png
/usr/share/doc/qt/qtwebengine/images/minimal-example.png
/usr/share/doc/qt/qtwebengine/images/notifications-example.png
/usr/share/doc/qt/qtwebengine/images/printme-example.png
/usr/share/doc/qt/qtwebengine/images/qtwebengine-architecture.png
/usr/share/doc/qt/qtwebengine/images/qtwebengine-model.png
/usr/share/doc/qt/qtwebengine/images/qtwebenginewidgets-model.png
/usr/share/doc/qt/qtwebengine/images/quicknanobrowser-demo.jpg
/usr/share/doc/qt/qtwebengine/images/recipebrowser-demo.jpg
/usr/share/doc/qt/qtwebengine/images/simplebrowser-model.png
/usr/share/doc/qt/qtwebengine/images/simplebrowser.png
/usr/share/doc/qt/qtwebengine/images/spellchecker-example.png
/usr/share/doc/qt/qtwebengine/images/stylesheetbrowser.png
/usr/share/doc/qt/qtwebengine/images/videoplayer-example.png
/usr/share/doc/qt/qtwebengine/images/webengineaction-example.png
/usr/share/doc/qt/qtwebengine/images/webui-example.png
/usr/share/doc/qt/qtwebengine/style/offline-simple.css
/usr/share/doc/qt/qtwebengine/style/offline.css
/usr/share/doc/qt/qtwebsockets/echoclient.html
/usr/share/doc/qt/qtwebsockets/echoserver.html
/usr/share/doc/qt/qtwebsockets/examples-manifest.xml
/usr/share/doc/qt/qtwebsockets/qmaskgenerator-members.html
/usr/share/doc/qt/qtwebsockets/qmaskgenerator.html
/usr/share/doc/qt/qtwebsockets/qml-qtwebsockets-websocket-members.html
/usr/share/doc/qt/qtwebsockets/qml-qtwebsockets-websocket.html
/usr/share/doc/qt/qtwebsockets/qml-qtwebsockets-websocketserver-members.html
/usr/share/doc/qt/qtwebsockets/qml-qtwebsockets-websocketserver.html
/usr/share/doc/qt/qtwebsockets/qtwebsockets-echoclient-example.html
/usr/share/doc/qt/qtwebsockets/qtwebsockets-echoserver-example.html
/usr/share/doc/qt/qtwebsockets/qtwebsockets-examples.html
/usr/share/doc/qt/qtwebsockets/qtwebsockets-index.html
/usr/share/doc/qt/qtwebsockets/qtwebsockets-module.html
/usr/share/doc/qt/qtwebsockets/qtwebsockets-qmlmodule.html
/usr/share/doc/qt/qtwebsockets/qtwebsockets-qmlwebsocketclient-example.html
/usr/share/doc/qt/qtwebsockets/qtwebsockets-qmlwebsocketserver-example.html
/usr/share/doc/qt/qtwebsockets/qtwebsockets-simplechat-example.html
/usr/share/doc/qt/qtwebsockets/qtwebsockets-sslechoclient-example.html
/usr/share/doc/qt/qtwebsockets/qtwebsockets-sslechoserver-example.html
/usr/share/doc/qt/qtwebsockets/qtwebsockets-testing.html
/usr/share/doc/qt/qtwebsockets/qtwebsockets.index
/usr/share/doc/qt/qtwebsockets/qtwebsockets.qhp
/usr/share/doc/qt/qtwebsockets/qtwebsockets.qhp.sha1
/usr/share/doc/qt/qtwebsockets/qtwebsockets.tags
/usr/share/doc/qt/qtwebsockets/qwebsocket-members.html
/usr/share/doc/qt/qtwebsockets/qwebsocket.html
/usr/share/doc/qt/qtwebsockets/qwebsocketcorsauthenticator-members.html
/usr/share/doc/qt/qtwebsockets/qwebsocketcorsauthenticator.html
/usr/share/doc/qt/qtwebsockets/qwebsocketprotocol.html
/usr/share/doc/qt/qtwebsockets/qwebsocketserver-members.html
/usr/share/doc/qt/qtwebsockets/qwebsocketserver-obsolete.html
/usr/share/doc/qt/qtwebsockets/qwebsocketserver.html
/usr/share/doc/qt/qtwebsockets/websockets-overview.html
/usr/share/doc/qt/qtwebsockets/images/arrow_bc.png
/usr/share/doc/qt/qtwebsockets/images/bgrContent.png
/usr/share/doc/qt/qtwebsockets/images/btn_next.png
/usr/share/doc/qt/qtwebsockets/images/btn_prev.png
/usr/share/doc/qt/qtwebsockets/images/bullet_dn.png
/usr/share/doc/qt/qtwebsockets/images/bullet_sq.png
/usr/share/doc/qt/qtwebsockets/images/echoclient-html-example.png
/usr/share/doc/qt/qtwebsockets/images/home.png
/usr/share/doc/qt/qtwebsockets/images/ico_note.png
/usr/share/doc/qt/qtwebsockets/images/ico_note_attention.png
/usr/share/doc/qt/qtwebsockets/images/ico_out.png
/usr/share/doc/qt/qtwebsockets/images/logo.png
/usr/share/doc/qt/qtwebsockets/images/websockets-pictorial-representation.jpg
/usr/share/doc/qt/qtwebsockets/style/offline-simple.css
/usr/share/doc/qt/qtwebsockets/style/offline.css
/usr/share/doc/qt/qtwebview/examples-manifest.xml
/usr/share/doc/qt/qtwebview/qml-qtwebview-webview-members.html
/usr/share/doc/qt/qtwebview/qml-qtwebview-webview.html
/usr/share/doc/qt/qtwebview/qml-qtwebview-webviewloadrequest-members.html
/usr/share/doc/qt/qtwebview/qml-qtwebview-webviewloadrequest.html
/usr/share/doc/qt/qtwebview/qtwebview-examples.html
/usr/share/doc/qt/qtwebview/qtwebview-index.html
/usr/share/doc/qt/qtwebview/qtwebview-minibrowser-example.html
/usr/share/doc/qt/qtwebview/qtwebview-module.html
/usr/share/doc/qt/qtwebview/qtwebview-qmlmodule.html
/usr/share/doc/qt/qtwebview/qtwebview.html
/usr/share/doc/qt/qtwebview/qtwebview.index
/usr/share/doc/qt/qtwebview/qtwebview.qhp
/usr/share/doc/qt/qtwebview/qtwebview.qhp.sha1
/usr/share/doc/qt/qtwebview/images/arrow_bc.png
/usr/share/doc/qt/qtwebview/images/bgrContent.png
/usr/share/doc/qt/qtwebview/images/btn_next.png
/usr/share/doc/qt/qtwebview/images/btn_prev.png
/usr/share/doc/qt/qtwebview/images/bullet_dn.png
/usr/share/doc/qt/qtwebview/images/bullet_sq.png
/usr/share/doc/qt/qtwebview/images/home.png
/usr/share/doc/qt/qtwebview/images/ico_note.png
/usr/share/doc/qt/qtwebview/images/ico_note_attention.png
/usr/share/doc/qt/qtwebview/images/ico_out.png
/usr/share/doc/qt/qtwebview/images/logo.png
/usr/share/doc/qt/qtwebview/images/webview-example.jpg
/usr/share/doc/qt/qtwebview/style/offline-simple.css
/usr/share/doc/qt/qtwebview/style/offline.css
/usr/share/doc/qt/qtwidgets/application-windows.html
/usr/share/doc/qt/qtwidgets/dialogs.html
/usr/share/doc/qt/qtwidgets/examples-desktop.html
/usr/share/doc/qt/qtwidgets/examples-dialogs.html
/usr/share/doc/qt/qtwidgets/examples-graphicsview.html
/usr/share/doc/qt/qtwidgets/examples-itemviews.html
/usr/share/doc/qt/qtwidgets/examples-mainwindow.html
/usr/share/doc/qt/qtwidgets/examples-manifest.xml
/usr/share/doc/qt/qtwidgets/examples-painting.html
/usr/share/doc/qt/qtwidgets/examples-richtext.html
/usr/share/doc/qt/qtwidgets/examples-widgets.html
/usr/share/doc/qt/qtwidgets/focus.html
/usr/share/doc/qt/qtwidgets/gallery.html
/usr/share/doc/qt/qtwidgets/gestures-overview.html
/usr/share/doc/qt/qtwidgets/graphicsview.html
/usr/share/doc/qt/qtwidgets/guibooks.html
/usr/share/doc/qt/qtwidgets/layout.html
/usr/share/doc/qt/qtwidgets/mainwindow.html
/usr/share/doc/qt/qtwidgets/model-view-programming.html
/usr/share/doc/qt/qtwidgets/modelview-part2-main-cpp.html
/usr/share/doc/qt/qtwidgets/modelview.html
/usr/share/doc/qt/qtwidgets/qabstractbutton-members.html
/usr/share/doc/qt/qtwidgets/qabstractbutton.html
/usr/share/doc/qt/qtwidgets/qabstractgraphicsshapeitem-members.html
/usr/share/doc/qt/qtwidgets/qabstractgraphicsshapeitem.html
/usr/share/doc/qt/qtwidgets/qabstractitemdelegate-members.html
/usr/share/doc/qt/qtwidgets/qabstractitemdelegate.html
/usr/share/doc/qt/qtwidgets/qabstractitemview-members.html
/usr/share/doc/qt/qtwidgets/qabstractitemview-obsolete.html
/usr/share/doc/qt/qtwidgets/qabstractitemview.html
/usr/share/doc/qt/qtwidgets/qabstractscrollarea-members.html
/usr/share/doc/qt/qtwidgets/qabstractscrollarea.html
/usr/share/doc/qt/qtwidgets/qabstractslider-members.html
/usr/share/doc/qt/qtwidgets/qabstractslider.html
/usr/share/doc/qt/qtwidgets/qabstractspinbox-members.html
/usr/share/doc/qt/qtwidgets/qabstractspinbox.html
/usr/share/doc/qt/qtwidgets/qaccessiblewidget-members.html
/usr/share/doc/qt/qtwidgets/qaccessiblewidget.html
/usr/share/doc/qt/qtwidgets/qaction-members.html
/usr/share/doc/qt/qtwidgets/qaction.html
/usr/share/doc/qt/qtwidgets/qactiongroup-members.html
/usr/share/doc/qt/qtwidgets/qactiongroup.html
/usr/share/doc/qt/qtwidgets/qapplication-members.html
/usr/share/doc/qt/qtwidgets/qapplication-obsolete.html
/usr/share/doc/qt/qtwidgets/qapplication.html
/usr/share/doc/qt/qtwidgets/qboxlayout-members.html
/usr/share/doc/qt/qtwidgets/qboxlayout.html
/usr/share/doc/qt/qtwidgets/qbuttongroup-members.html
/usr/share/doc/qt/qtwidgets/qbuttongroup.html
/usr/share/doc/qt/qtwidgets/qcalendarwidget-members.html
/usr/share/doc/qt/qtwidgets/qcalendarwidget.html
/usr/share/doc/qt/qtwidgets/qcheckbox-members.html
/usr/share/doc/qt/qtwidgets/qcheckbox.html
/usr/share/doc/qt/qtwidgets/qcolordialog-members.html
/usr/share/doc/qt/qtwidgets/qcolordialog-obsolete.html
/usr/share/doc/qt/qtwidgets/qcolordialog.html
/usr/share/doc/qt/qtwidgets/qcolormap-members.html
/usr/share/doc/qt/qtwidgets/qcolormap.html
/usr/share/doc/qt/qtwidgets/qcolumnview-members.html
/usr/share/doc/qt/qtwidgets/qcolumnview.html
/usr/share/doc/qt/qtwidgets/qcombobox-members.html
/usr/share/doc/qt/qtwidgets/qcombobox-obsolete.html
/usr/share/doc/qt/qtwidgets/qcombobox.html
/usr/share/doc/qt/qtwidgets/qcommandlinkbutton-members.html
/usr/share/doc/qt/qtwidgets/qcommandlinkbutton.html
/usr/share/doc/qt/qtwidgets/qcommonstyle-members.html
/usr/share/doc/qt/qtwidgets/qcommonstyle.html
/usr/share/doc/qt/qtwidgets/qcompleter-members.html
/usr/share/doc/qt/qtwidgets/qcompleter.html
/usr/share/doc/qt/qtwidgets/qdatawidgetmapper-members.html
/usr/share/doc/qt/qtwidgets/qdatawidgetmapper.html
/usr/share/doc/qt/qtwidgets/qdateedit-members.html
/usr/share/doc/qt/qtwidgets/qdateedit.html
/usr/share/doc/qt/qtwidgets/qdatetimeedit-members.html
/usr/share/doc/qt/qtwidgets/qdatetimeedit.html
/usr/share/doc/qt/qtwidgets/qdesktopwidget-members.html
/usr/share/doc/qt/qtwidgets/qdesktopwidget-obsolete.html
/usr/share/doc/qt/qtwidgets/qdesktopwidget.html
/usr/share/doc/qt/qtwidgets/qdial-members.html
/usr/share/doc/qt/qtwidgets/qdial.html
/usr/share/doc/qt/qtwidgets/qdialog-members.html
/usr/share/doc/qt/qtwidgets/qdialog-obsolete.html
/usr/share/doc/qt/qtwidgets/qdialog.html
/usr/share/doc/qt/qtwidgets/qdialogbuttonbox-members.html
/usr/share/doc/qt/qtwidgets/qdialogbuttonbox.html
/usr/share/doc/qt/qtwidgets/qdirmodel-members.html
/usr/share/doc/qt/qtwidgets/qdirmodel.html
/usr/share/doc/qt/qtwidgets/qdockwidget-members.html
/usr/share/doc/qt/qtwidgets/qdockwidget.html
/usr/share/doc/qt/qtwidgets/qdoublespinbox-members.html
/usr/share/doc/qt/qtwidgets/qdoublespinbox.html
/usr/share/doc/qt/qtwidgets/qdrawutil-h.html
/usr/share/doc/qt/qtwidgets/qerrormessage-members.html
/usr/share/doc/qt/qtwidgets/qerrormessage.html
/usr/share/doc/qt/qtwidgets/qfiledialog-members.html
/usr/share/doc/qt/qtwidgets/qfiledialog-obsolete.html
/usr/share/doc/qt/qtwidgets/qfiledialog.html
/usr/share/doc/qt/qtwidgets/qfileiconprovider-members.html
/usr/share/doc/qt/qtwidgets/qfileiconprovider.html
/usr/share/doc/qt/qtwidgets/qfilesystemmodel-members.html
/usr/share/doc/qt/qtwidgets/qfilesystemmodel.html
/usr/share/doc/qt/qtwidgets/qfocusframe-members.html
/usr/share/doc/qt/qtwidgets/qfocusframe.html
/usr/share/doc/qt/qtwidgets/qfontcombobox-members.html
/usr/share/doc/qt/qtwidgets/qfontcombobox.html
/usr/share/doc/qt/qtwidgets/qfontdialog-members.html
/usr/share/doc/qt/qtwidgets/qfontdialog.html
/usr/share/doc/qt/qtwidgets/qformlayout-members.html
/usr/share/doc/qt/qtwidgets/qformlayout-takerowresult-members.html
/usr/share/doc/qt/qtwidgets/qformlayout-takerowresult.html
/usr/share/doc/qt/qtwidgets/qformlayout.html
/usr/share/doc/qt/qtwidgets/qframe-members.html
/usr/share/doc/qt/qtwidgets/qframe.html
/usr/share/doc/qt/qtwidgets/qgesture-members.html
/usr/share/doc/qt/qtwidgets/qgesture.html
/usr/share/doc/qt/qtwidgets/qgestureevent-members.html
/usr/share/doc/qt/qtwidgets/qgestureevent.html
/usr/share/doc/qt/qtwidgets/qgesturerecognizer-members.html
/usr/share/doc/qt/qtwidgets/qgesturerecognizer.html
/usr/share/doc/qt/qtwidgets/qgraphicsanchor-members.html
/usr/share/doc/qt/qtwidgets/qgraphicsanchor.html
/usr/share/doc/qt/qtwidgets/qgraphicsanchorlayout-members.html
/usr/share/doc/qt/qtwidgets/qgraphicsanchorlayout.html
/usr/share/doc/qt/qtwidgets/qgraphicsblureffect-members.html
/usr/share/doc/qt/qtwidgets/qgraphicsblureffect.html
/usr/share/doc/qt/qtwidgets/qgraphicscolorizeeffect-members.html
/usr/share/doc/qt/qtwidgets/qgraphicscolorizeeffect.html
/usr/share/doc/qt/qtwidgets/qgraphicsdropshadoweffect-members.html
/usr/share/doc/qt/qtwidgets/qgraphicsdropshadoweffect.html
/usr/share/doc/qt/qtwidgets/qgraphicseffect-members.html
/usr/share/doc/qt/qtwidgets/qgraphicseffect.html
/usr/share/doc/qt/qtwidgets/qgraphicsellipseitem-members.html
/usr/share/doc/qt/qtwidgets/qgraphicsellipseitem.html
/usr/share/doc/qt/qtwidgets/qgraphicsgridlayout-members.html
/usr/share/doc/qt/qtwidgets/qgraphicsgridlayout.html
/usr/share/doc/qt/qtwidgets/qgraphicsitem-members.html
/usr/share/doc/qt/qtwidgets/qgraphicsitem-obsolete.html
/usr/share/doc/qt/qtwidgets/qgraphicsitem.html
/usr/share/doc/qt/qtwidgets/qgraphicsitemanimation-members.html
/usr/share/doc/qt/qtwidgets/qgraphicsitemanimation-obsolete.html
/usr/share/doc/qt/qtwidgets/qgraphicsitemanimation.html
/usr/share/doc/qt/qtwidgets/qgraphicsitemgroup-members.html
/usr/share/doc/qt/qtwidgets/qgraphicsitemgroup.html
/usr/share/doc/qt/qtwidgets/qgraphicslayout-members.html
/usr/share/doc/qt/qtwidgets/qgraphicslayout.html
/usr/share/doc/qt/qtwidgets/qgraphicslayoutitem-members.html
/usr/share/doc/qt/qtwidgets/qgraphicslayoutitem.html
/usr/share/doc/qt/qtwidgets/qgraphicslinearlayout-members.html
/usr/share/doc/qt/qtwidgets/qgraphicslinearlayout.html
/usr/share/doc/qt/qtwidgets/qgraphicslineitem-members.html
/usr/share/doc/qt/qtwidgets/qgraphicslineitem.html
/usr/share/doc/qt/qtwidgets/qgraphicsobject-members.html
/usr/share/doc/qt/qtwidgets/qgraphicsobject.html
/usr/share/doc/qt/qtwidgets/qgraphicsopacityeffect-members.html
/usr/share/doc/qt/qtwidgets/qgraphicsopacityeffect.html
/usr/share/doc/qt/qtwidgets/qgraphicspathitem-members.html
/usr/share/doc/qt/qtwidgets/qgraphicspathitem.html
/usr/share/doc/qt/qtwidgets/qgraphicspixmapitem-members.html
/usr/share/doc/qt/qtwidgets/qgraphicspixmapitem.html
/usr/share/doc/qt/qtwidgets/qgraphicspolygonitem-members.html
/usr/share/doc/qt/qtwidgets/qgraphicspolygonitem.html
/usr/share/doc/qt/qtwidgets/qgraphicsproxywidget-members.html
/usr/share/doc/qt/qtwidgets/qgraphicsproxywidget.html
/usr/share/doc/qt/qtwidgets/qgraphicsrectitem-members.html
/usr/share/doc/qt/qtwidgets/qgraphicsrectitem.html
/usr/share/doc/qt/qtwidgets/qgraphicsrotation-members.html
/usr/share/doc/qt/qtwidgets/qgraphicsrotation.html
/usr/share/doc/qt/qtwidgets/qgraphicsscale-members.html
/usr/share/doc/qt/qtwidgets/qgraphicsscale.html
/usr/share/doc/qt/qtwidgets/qgraphicsscene-members.html
/usr/share/doc/qt/qtwidgets/qgraphicsscene-obsolete.html
/usr/share/doc/qt/qtwidgets/qgraphicsscene.html
/usr/share/doc/qt/qtwidgets/qgraphicsscenecontextmenuevent-members.html
/usr/share/doc/qt/qtwidgets/qgraphicsscenecontextmenuevent.html
/usr/share/doc/qt/qtwidgets/qgraphicsscenedragdropevent-members.html
/usr/share/doc/qt/qtwidgets/qgraphicsscenedragdropevent.html
/usr/share/doc/qt/qtwidgets/qgraphicssceneevent-members.html
/usr/share/doc/qt/qtwidgets/qgraphicssceneevent.html
/usr/share/doc/qt/qtwidgets/qgraphicsscenehelpevent-members.html
/usr/share/doc/qt/qtwidgets/qgraphicsscenehelpevent.html
/usr/share/doc/qt/qtwidgets/qgraphicsscenehoverevent-members.html
/usr/share/doc/qt/qtwidgets/qgraphicsscenehoverevent.html
/usr/share/doc/qt/qtwidgets/qgraphicsscenemouseevent-members.html
/usr/share/doc/qt/qtwidgets/qgraphicsscenemouseevent.html
/usr/share/doc/qt/qtwidgets/qgraphicsscenemoveevent-members.html
/usr/share/doc/qt/qtwidgets/qgraphicsscenemoveevent.html
/usr/share/doc/qt/qtwidgets/qgraphicssceneresizeevent-members.html
/usr/share/doc/qt/qtwidgets/qgraphicssceneresizeevent.html
/usr/share/doc/qt/qtwidgets/qgraphicsscenewheelevent-members.html
/usr/share/doc/qt/qtwidgets/qgraphicsscenewheelevent.html
/usr/share/doc/qt/qtwidgets/qgraphicssimpletextitem-members.html
/usr/share/doc/qt/qtwidgets/qgraphicssimpletextitem.html
/usr/share/doc/qt/qtwidgets/qgraphicstextitem-members.html
/usr/share/doc/qt/qtwidgets/qgraphicstextitem.html
/usr/share/doc/qt/qtwidgets/qgraphicstransform-members.html
/usr/share/doc/qt/qtwidgets/qgraphicstransform.html
/usr/share/doc/qt/qtwidgets/qgraphicsview-members.html
/usr/share/doc/qt/qtwidgets/qgraphicsview-obsolete.html
/usr/share/doc/qt/qtwidgets/qgraphicsview.html
/usr/share/doc/qt/qtwidgets/qgraphicswidget-members.html
/usr/share/doc/qt/qtwidgets/qgraphicswidget.html
/usr/share/doc/qt/qtwidgets/qgridlayout-members.html
/usr/share/doc/qt/qtwidgets/qgridlayout.html
/usr/share/doc/qt/qtwidgets/qgroupbox-members.html
/usr/share/doc/qt/qtwidgets/qgroupbox.html
/usr/share/doc/qt/qtwidgets/qhboxlayout-members.html
/usr/share/doc/qt/qtwidgets/qhboxlayout.html
/usr/share/doc/qt/qtwidgets/qheaderview-members.html
/usr/share/doc/qt/qtwidgets/qheaderview-obsolete.html
/usr/share/doc/qt/qtwidgets/qheaderview.html
/usr/share/doc/qt/qtwidgets/qinputdialog-members.html
/usr/share/doc/qt/qtwidgets/qinputdialog-obsolete.html
/usr/share/doc/qt/qtwidgets/qinputdialog.html
/usr/share/doc/qt/qtwidgets/qitemdelegate-members.html
/usr/share/doc/qt/qtwidgets/qitemdelegate.html
/usr/share/doc/qt/qtwidgets/qitemeditorcreator-members.html
/usr/share/doc/qt/qtwidgets/qitemeditorcreator.html
/usr/share/doc/qt/qtwidgets/qitemeditorcreatorbase-members.html
/usr/share/doc/qt/qtwidgets/qitemeditorcreatorbase.html
/usr/share/doc/qt/qtwidgets/qitemeditorfactory-members.html
/usr/share/doc/qt/qtwidgets/qitemeditorfactory.html
/usr/share/doc/qt/qtwidgets/qkeyeventtransition-members.html
/usr/share/doc/qt/qtwidgets/qkeyeventtransition.html
/usr/share/doc/qt/qtwidgets/qkeysequenceedit-members.html
/usr/share/doc/qt/qtwidgets/qkeysequenceedit.html
/usr/share/doc/qt/qtwidgets/qlabel-members.html
/usr/share/doc/qt/qtwidgets/qlabel.html
/usr/share/doc/qt/qtwidgets/qlayout-members.html
/usr/share/doc/qt/qtwidgets/qlayout-obsolete.html
/usr/share/doc/qt/qtwidgets/qlayout.html
/usr/share/doc/qt/qtwidgets/qlayoutitem-members.html
/usr/share/doc/qt/qtwidgets/qlayoutitem.html
/usr/share/doc/qt/qtwidgets/qlcdnumber-members.html
/usr/share/doc/qt/qtwidgets/qlcdnumber.html
/usr/share/doc/qt/qtwidgets/qlineedit-members.html
/usr/share/doc/qt/qtwidgets/qlineedit.html
/usr/share/doc/qt/qtwidgets/qlistview-members.html
/usr/share/doc/qt/qtwidgets/qlistview.html
/usr/share/doc/qt/qtwidgets/qlistwidget-members.html
/usr/share/doc/qt/qtwidgets/qlistwidget-obsolete.html
/usr/share/doc/qt/qtwidgets/qlistwidget.html
/usr/share/doc/qt/qtwidgets/qlistwidgetitem-members.html
/usr/share/doc/qt/qtwidgets/qlistwidgetitem-obsolete.html
/usr/share/doc/qt/qtwidgets/qlistwidgetitem.html
/usr/share/doc/qt/qtwidgets/qmaccocoaviewcontainer-members.html
/usr/share/doc/qt/qtwidgets/qmaccocoaviewcontainer.html
/usr/share/doc/qt/qtwidgets/qmacnativewidget-members.html
/usr/share/doc/qt/qtwidgets/qmacnativewidget.html
/usr/share/doc/qt/qtwidgets/qmainwindow-members.html
/usr/share/doc/qt/qtwidgets/qmainwindow.html
/usr/share/doc/qt/qtwidgets/qmdiarea-members.html
/usr/share/doc/qt/qtwidgets/qmdiarea.html
/usr/share/doc/qt/qtwidgets/qmdisubwindow-members.html
/usr/share/doc/qt/qtwidgets/qmdisubwindow.html
/usr/share/doc/qt/qtwidgets/qmenu-members.html
/usr/share/doc/qt/qtwidgets/qmenu.html
/usr/share/doc/qt/qtwidgets/qmenubar-members.html
/usr/share/doc/qt/qtwidgets/qmenubar.html
/usr/share/doc/qt/qtwidgets/qmessagebox-members.html
/usr/share/doc/qt/qtwidgets/qmessagebox-obsolete.html
/usr/share/doc/qt/qtwidgets/qmessagebox.html
/usr/share/doc/qt/qtwidgets/qmouseeventtransition-members.html
/usr/share/doc/qt/qtwidgets/qmouseeventtransition.html
/usr/share/doc/qt/qtwidgets/qopenglwidget-members.html
/usr/share/doc/qt/qtwidgets/qopenglwidget.html
/usr/share/doc/qt/qtwidgets/qpangesture-members.html
/usr/share/doc/qt/qtwidgets/qpangesture.html
/usr/share/doc/qt/qtwidgets/qpinchgesture-members.html
/usr/share/doc/qt/qtwidgets/qpinchgesture.html
/usr/share/doc/qt/qtwidgets/qplaintextdocumentlayout-members.html
/usr/share/doc/qt/qtwidgets/qplaintextdocumentlayout.html
/usr/share/doc/qt/qtwidgets/qplaintextedit-members.html
/usr/share/doc/qt/qtwidgets/qplaintextedit-obsolete.html
/usr/share/doc/qt/qtwidgets/qplaintextedit.html
/usr/share/doc/qt/qtwidgets/qprogressbar-members.html
/usr/share/doc/qt/qtwidgets/qprogressbar.html
/usr/share/doc/qt/qtwidgets/qprogressdialog-members.html
/usr/share/doc/qt/qtwidgets/qprogressdialog.html
/usr/share/doc/qt/qtwidgets/qproxystyle-members.html
/usr/share/doc/qt/qtwidgets/qproxystyle.html
/usr/share/doc/qt/qtwidgets/qpushbutton-members.html
/usr/share/doc/qt/qtwidgets/qpushbutton.html
/usr/share/doc/qt/qtwidgets/qradiobutton-members.html
/usr/share/doc/qt/qtwidgets/qradiobutton.html
/usr/share/doc/qt/qtwidgets/qrubberband-members.html
/usr/share/doc/qt/qtwidgets/qrubberband.html
/usr/share/doc/qt/qtwidgets/qscrollarea-members.html
/usr/share/doc/qt/qtwidgets/qscrollarea.html
/usr/share/doc/qt/qtwidgets/qscrollbar-members.html
/usr/share/doc/qt/qtwidgets/qscrollbar.html
/usr/share/doc/qt/qtwidgets/qscroller-members.html
/usr/share/doc/qt/qtwidgets/qscroller.html
/usr/share/doc/qt/qtwidgets/qscrollerproperties-members.html
/usr/share/doc/qt/qtwidgets/qscrollerproperties.html
/usr/share/doc/qt/qtwidgets/qshortcut-members.html
/usr/share/doc/qt/qtwidgets/qshortcut.html
/usr/share/doc/qt/qtwidgets/qsizegrip-members.html
/usr/share/doc/qt/qtwidgets/qsizegrip.html
/usr/share/doc/qt/qtwidgets/qsizepolicy-members.html
/usr/share/doc/qt/qtwidgets/qsizepolicy.html
/usr/share/doc/qt/qtwidgets/qslider-members.html
/usr/share/doc/qt/qtwidgets/qslider.html
/usr/share/doc/qt/qtwidgets/qspaceritem-members.html
/usr/share/doc/qt/qtwidgets/qspaceritem.html
/usr/share/doc/qt/qtwidgets/qspinbox-members.html
/usr/share/doc/qt/qtwidgets/qspinbox.html
/usr/share/doc/qt/qtwidgets/qsplashscreen-members.html
/usr/share/doc/qt/qtwidgets/qsplashscreen.html
/usr/share/doc/qt/qtwidgets/qsplitter-members.html
/usr/share/doc/qt/qtwidgets/qsplitter.html
/usr/share/doc/qt/qtwidgets/qsplitterhandle-members.html
/usr/share/doc/qt/qtwidgets/qsplitterhandle.html
/usr/share/doc/qt/qtwidgets/qstackedlayout-members.html
/usr/share/doc/qt/qtwidgets/qstackedlayout.html
/usr/share/doc/qt/qtwidgets/qstackedwidget-members.html
/usr/share/doc/qt/qtwidgets/qstackedwidget.html
/usr/share/doc/qt/qtwidgets/qstandarditemeditorcreator-members.html
/usr/share/doc/qt/qtwidgets/qstandarditemeditorcreator.html
/usr/share/doc/qt/qtwidgets/qstatusbar-members.html
/usr/share/doc/qt/qtwidgets/qstatusbar.html
/usr/share/doc/qt/qtwidgets/qstyle-members.html
/usr/share/doc/qt/qtwidgets/qstyle-obsolete.html
/usr/share/doc/qt/qtwidgets/qstyle.html
/usr/share/doc/qt/qtwidgets/qstyleditemdelegate-members.html
/usr/share/doc/qt/qtwidgets/qstyleditemdelegate.html
/usr/share/doc/qt/qtwidgets/qstylefactory-members.html
/usr/share/doc/qt/qtwidgets/qstylefactory.html
/usr/share/doc/qt/qtwidgets/qstylehintreturn-members.html
/usr/share/doc/qt/qtwidgets/qstylehintreturn.html
/usr/share/doc/qt/qtwidgets/qstylehintreturnmask-members.html
/usr/share/doc/qt/qtwidgets/qstylehintreturnmask.html
/usr/share/doc/qt/qtwidgets/qstylehintreturnvariant-members.html
/usr/share/doc/qt/qtwidgets/qstylehintreturnvariant.html
/usr/share/doc/qt/qtwidgets/qstyleoption-members.html
/usr/share/doc/qt/qtwidgets/qstyleoption-obsolete.html
/usr/share/doc/qt/qtwidgets/qstyleoption.html
/usr/share/doc/qt/qtwidgets/qstyleoptionbutton-members.html
/usr/share/doc/qt/qtwidgets/qstyleoptionbutton.html
/usr/share/doc/qt/qtwidgets/qstyleoptioncombobox-members.html
/usr/share/doc/qt/qtwidgets/qstyleoptioncombobox.html
/usr/share/doc/qt/qtwidgets/qstyleoptioncomplex-members.html
/usr/share/doc/qt/qtwidgets/qstyleoptioncomplex.html
/usr/share/doc/qt/qtwidgets/qstyleoptiondockwidget-members.html
/usr/share/doc/qt/qtwidgets/qstyleoptiondockwidget.html
/usr/share/doc/qt/qtwidgets/qstyleoptionfocusrect-members.html
/usr/share/doc/qt/qtwidgets/qstyleoptionfocusrect.html
/usr/share/doc/qt/qtwidgets/qstyleoptionframe-members.html
/usr/share/doc/qt/qtwidgets/qstyleoptionframe.html
/usr/share/doc/qt/qtwidgets/qstyleoptiongraphicsitem-members.html
/usr/share/doc/qt/qtwidgets/qstyleoptiongraphicsitem-obsolete.html
/usr/share/doc/qt/qtwidgets/qstyleoptiongraphicsitem.html
/usr/share/doc/qt/qtwidgets/qstyleoptiongroupbox-members.html
/usr/share/doc/qt/qtwidgets/qstyleoptiongroupbox.html
/usr/share/doc/qt/qtwidgets/qstyleoptionheader-members.html
/usr/share/doc/qt/qtwidgets/qstyleoptionheader.html
/usr/share/doc/qt/qtwidgets/qstyleoptionmenuitem-members.html
/usr/share/doc/qt/qtwidgets/qstyleoptionmenuitem.html
/usr/share/doc/qt/qtwidgets/qstyleoptionprogressbar-members.html
/usr/share/doc/qt/qtwidgets/qstyleoptionprogressbar-obsolete.html
/usr/share/doc/qt/qtwidgets/qstyleoptionprogressbar.html
/usr/share/doc/qt/qtwidgets/qstyleoptionrubberband-members.html
/usr/share/doc/qt/qtwidgets/qstyleoptionrubberband.html
/usr/share/doc/qt/qtwidgets/qstyleoptionsizegrip-members.html
/usr/share/doc/qt/qtwidgets/qstyleoptionsizegrip.html
/usr/share/doc/qt/qtwidgets/qstyleoptionslider-members.html
/usr/share/doc/qt/qtwidgets/qstyleoptionslider.html
/usr/share/doc/qt/qtwidgets/qstyleoptionspinbox-members.html
/usr/share/doc/qt/qtwidgets/qstyleoptionspinbox.html
/usr/share/doc/qt/qtwidgets/qstyleoptiontab-members.html
/usr/share/doc/qt/qtwidgets/qstyleoptiontab.html
/usr/share/doc/qt/qtwidgets/qstyleoptiontabbarbase-members.html
/usr/share/doc/qt/qtwidgets/qstyleoptiontabbarbase.html
/usr/share/doc/qt/qtwidgets/qstyleoptiontabwidgetframe-members.html
/usr/share/doc/qt/qtwidgets/qstyleoptiontabwidgetframe.html
/usr/share/doc/qt/qtwidgets/qstyleoptiontitlebar-members.html
/usr/share/doc/qt/qtwidgets/qstyleoptiontitlebar.html
/usr/share/doc/qt/qtwidgets/qstyleoptiontoolbar-members.html
/usr/share/doc/qt/qtwidgets/qstyleoptiontoolbar.html
/usr/share/doc/qt/qtwidgets/qstyleoptiontoolbox-members.html
/usr/share/doc/qt/qtwidgets/qstyleoptiontoolbox.html
/usr/share/doc/qt/qtwidgets/qstyleoptiontoolbutton-members.html
/usr/share/doc/qt/qtwidgets/qstyleoptiontoolbutton.html
/usr/share/doc/qt/qtwidgets/qstyleoptionviewitem-members.html
/usr/share/doc/qt/qtwidgets/qstyleoptionviewitem.html
/usr/share/doc/qt/qtwidgets/qstylepainter-members.html
/usr/share/doc/qt/qtwidgets/qstylepainter.html
/usr/share/doc/qt/qtwidgets/qstyleplugin-members.html
/usr/share/doc/qt/qtwidgets/qstyleplugin.html
/usr/share/doc/qt/qtwidgets/qswipegesture-members.html
/usr/share/doc/qt/qtwidgets/qswipegesture.html
/usr/share/doc/qt/qtwidgets/qsystemtrayicon-members.html
/usr/share/doc/qt/qtwidgets/qsystemtrayicon.html
/usr/share/doc/qt/qtwidgets/qtabbar-members.html
/usr/share/doc/qt/qtwidgets/qtabbar.html
/usr/share/doc/qt/qtwidgets/qtableview-members.html
/usr/share/doc/qt/qtwidgets/qtableview-obsolete.html
/usr/share/doc/qt/qtwidgets/qtableview.html
/usr/share/doc/qt/qtwidgets/qtablewidget-members.html
/usr/share/doc/qt/qtwidgets/qtablewidget-obsolete.html
/usr/share/doc/qt/qtwidgets/qtablewidget.html
/usr/share/doc/qt/qtwidgets/qtablewidgetitem-members.html
/usr/share/doc/qt/qtwidgets/qtablewidgetitem-obsolete.html
/usr/share/doc/qt/qtwidgets/qtablewidgetitem.html
/usr/share/doc/qt/qtwidgets/qtablewidgetselectionrange-members.html
/usr/share/doc/qt/qtwidgets/qtablewidgetselectionrange.html
/usr/share/doc/qt/qtwidgets/qtabwidget-members.html
/usr/share/doc/qt/qtwidgets/qtabwidget.html
/usr/share/doc/qt/qtwidgets/qtapandholdgesture-members.html
/usr/share/doc/qt/qtwidgets/qtapandholdgesture.html
/usr/share/doc/qt/qtwidgets/qtapgesture-members.html
/usr/share/doc/qt/qtwidgets/qtapgesture.html
/usr/share/doc/qt/qtwidgets/qtextbrowser-members.html
/usr/share/doc/qt/qtwidgets/qtextbrowser.html
/usr/share/doc/qt/qtwidgets/qtextedit-extraselection-members.html
/usr/share/doc/qt/qtwidgets/qtextedit-extraselection.html
/usr/share/doc/qt/qtwidgets/qtextedit-members.html
/usr/share/doc/qt/qtwidgets/qtextedit-obsolete.html
/usr/share/doc/qt/qtwidgets/qtextedit.html
/usr/share/doc/qt/qtwidgets/qtilerules-members.html
/usr/share/doc/qt/qtwidgets/qtilerules.html
/usr/share/doc/qt/qtwidgets/qtimeedit-members.html
/usr/share/doc/qt/qtwidgets/qtimeedit.html
/usr/share/doc/qt/qtwidgets/qtoolbar-members.html
/usr/share/doc/qt/qtwidgets/qtoolbar.html
/usr/share/doc/qt/qtwidgets/qtoolbox-members.html
/usr/share/doc/qt/qtwidgets/qtoolbox.html
/usr/share/doc/qt/qtwidgets/qtoolbutton-members.html
/usr/share/doc/qt/qtwidgets/qtoolbutton.html
/usr/share/doc/qt/qtwidgets/qtooltip-members.html
/usr/share/doc/qt/qtwidgets/qtooltip.html
/usr/share/doc/qt/qtwidgets/qtreeview-members.html
/usr/share/doc/qt/qtwidgets/qtreeview-obsolete.html
/usr/share/doc/qt/qtwidgets/qtreeview.html
/usr/share/doc/qt/qtwidgets/qtreewidget-members.html
/usr/share/doc/qt/qtwidgets/qtreewidget-obsolete.html
/usr/share/doc/qt/qtwidgets/qtreewidget.html
/usr/share/doc/qt/qtwidgets/qtreewidgetitem-members.html
/usr/share/doc/qt/qtwidgets/qtreewidgetitem-obsolete.html
/usr/share/doc/qt/qtwidgets/qtreewidgetitem.html
/usr/share/doc/qt/qtwidgets/qtreewidgetitemiterator-members.html
/usr/share/doc/qt/qtwidgets/qtreewidgetitemiterator.html
/usr/share/doc/qt/qtwidgets/qtwidgets-animation-animatedtiles-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-animation-easing-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-animation-moveblocks-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-animation-states-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-animation-stickman-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-animation-sub-attaq-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-cmake-qt5-wrap-ui.html
/usr/share/doc/qt/qtwidgets/qtwidgets-desktop-screenshot-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-desktop-systray-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-dialogs-classwizard-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-dialogs-extension-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-dialogs-findfiles-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-dialogs-licensewizard-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-dialogs-standarddialogs-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-dialogs-tabdialog-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-dialogs-trivialwizard-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-draganddrop-draggableicons-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-draganddrop-draggabletext-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-draganddrop-dropsite-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-draganddrop-fridgemagnets-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-draganddrop-puzzle-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-effects-blurpicker-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-effects-fademessage-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-gestures-imagegestures-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-graphicsview-anchorlayout-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-graphicsview-basicgraphicslayouts-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-graphicsview-boxes-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-graphicsview-chip-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-graphicsview-collidingmice-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-graphicsview-diagramscene-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-graphicsview-dragdroprobot-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-graphicsview-elasticnodes-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-graphicsview-embeddeddialogs-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-graphicsview-flowlayout-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-graphicsview-padnavigator-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-graphicsview-simpleanchorlayout-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-graphicsview-weatheranchorlayout-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-index.html
/usr/share/doc/qt/qtwidgets/qtwidgets-itemviews-addressbook-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-itemviews-basicsortfiltermodel-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-itemviews-chart-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-itemviews-coloreditorfactory-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-itemviews-combowidgetmapper-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-itemviews-customsortfiltermodel-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-itemviews-dirview-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-itemviews-editabletreemodel-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-itemviews-fetchmore-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-itemviews-frozencolumn-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-itemviews-interview-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-itemviews-pixelator-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-itemviews-puzzle-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-itemviews-simpledommodel-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-itemviews-simpletreemodel-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-itemviews-simplewidgetmapper-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-itemviews-spinboxdelegate-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-itemviews-spreadsheet-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-itemviews-stardelegate-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-layouts-basiclayouts-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-layouts-borderlayout-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-layouts-dynamiclayouts-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-layouts-flowlayout-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-mainwindows-application-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-mainwindows-dockwidgets-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-mainwindows-mainwindow-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-mainwindows-mdi-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-mainwindows-menus-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-mainwindows-sdi-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-module.html
/usr/share/doc/qt/qtwidgets/qtwidgets-painting-affine-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-painting-basicdrawing-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-painting-composition-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-painting-concentriccircles-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-painting-deform-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-painting-fontsampler-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-painting-gradients-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-painting-imagecomposition-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-painting-painterpaths-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-painting-pathstroke-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-painting-transformations-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-richtext-calendar-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-richtext-orderform-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-richtext-syntaxhighlighter-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-richtext-textedit-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-statemachine-eventtransitions-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-statemachine-factorial-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-statemachine-pingpong-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-statemachine-rogue-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-statemachine-trafficlight-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-statemachine-twowaybutton-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tools-codecs-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tools-completer-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tools-customcompleter-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tools-echoplugin-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tools-i18n-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tools-plugandpaint-app-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tools-plugandpaint-plugins-basictools-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tools-plugandpaint-plugins-extrafilters-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tools-regexp-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tools-regularexpression-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tools-settingseditor-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tools-styleplugin-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tools-treemodelcompleter-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tools-undo-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tools-undoframework-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-touch-dials-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-touch-fingerpaint-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-touch-knobs-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-touch-pinchzoom-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tutorials-addressbook-part1-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tutorials-addressbook-part2-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tutorials-addressbook-part3-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tutorials-addressbook-part4-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tutorials-addressbook-part5-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tutorials-addressbook-part6-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tutorials-addressbook-part7-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tutorials-notepad-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tutorials-widgets-childwidget-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tutorials-widgets-nestedlayouts-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tutorials-widgets-toplevel-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-tutorials-widgets-windowlayout-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-widgets-analogclock-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-widgets-calculator-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-widgets-calendarwidget-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-widgets-charactermap-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-widgets-codeeditor-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-widgets-digitalclock-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-widgets-elidedlabel-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-widgets-groupbox-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-widgets-icons-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-widgets-imageviewer-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-widgets-lineedits-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-widgets-mousebuttons-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-widgets-movie-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-widgets-scribble-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-widgets-shapedclock-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-widgets-sliders-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-widgets-spinboxes-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-widgets-styles-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-widgets-stylesheet-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-widgets-tablet-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-widgets-tetrix-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-widgets-tooltips-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-widgets-validators-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-widgets-wiggly-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets-widgets-windowflags-example.html
/usr/share/doc/qt/qtwidgets/qtwidgets.index
/usr/share/doc/qt/qtwidgets/qtwidgets.qhp
/usr/share/doc/qt/qtwidgets/qtwidgets.qhp.sha1
/usr/share/doc/qt/qtwidgets/qtwidgets.tags
/usr/share/doc/qt/qtwidgets/qundocommand-members.html
/usr/share/doc/qt/qtwidgets/qundocommand.html
/usr/share/doc/qt/qtwidgets/qundogroup-members.html
/usr/share/doc/qt/qtwidgets/qundogroup.html
/usr/share/doc/qt/qtwidgets/qundostack-members.html
/usr/share/doc/qt/qtwidgets/qundostack.html
/usr/share/doc/qt/qtwidgets/qundoview-members.html
/usr/share/doc/qt/qtwidgets/qundoview.html
/usr/share/doc/qt/qtwidgets/qvboxlayout-members.html
/usr/share/doc/qt/qtwidgets/qvboxlayout.html
/usr/share/doc/qt/qtwidgets/qwhatsthis-members.html
/usr/share/doc/qt/qtwidgets/qwhatsthis.html
/usr/share/doc/qt/qtwidgets/qwidget-members.html
/usr/share/doc/qt/qtwidgets/qwidget-obsolete.html
/usr/share/doc/qt/qtwidgets/qwidget-styling.html
/usr/share/doc/qt/qtwidgets/qwidget.html
/usr/share/doc/qt/qtwidgets/qwidgetaction-members.html
/usr/share/doc/qt/qtwidgets/qwidgetaction.html
/usr/share/doc/qt/qtwidgets/qwidgetitem-members.html
/usr/share/doc/qt/qtwidgets/qwidgetitem.html
/usr/share/doc/qt/qtwidgets/qwizard-members.html
/usr/share/doc/qt/qtwidgets/qwizard.html
/usr/share/doc/qt/qtwidgets/qwizardpage-members.html
/usr/share/doc/qt/qtwidgets/qwizardpage.html
/usr/share/doc/qt/qtwidgets/standard-dialogs.html
/usr/share/doc/qt/qtwidgets/style-reference.html
/usr/share/doc/qt/qtwidgets/stylesheet-customizing.html
/usr/share/doc/qt/qtwidgets/stylesheet-designer.html
/usr/share/doc/qt/qtwidgets/stylesheet-examples.html
/usr/share/doc/qt/qtwidgets/stylesheet-reference.html
/usr/share/doc/qt/qtwidgets/stylesheet-syntax.html
/usr/share/doc/qt/qtwidgets/stylesheet.html
/usr/share/doc/qt/qtwidgets/textedit-example.html
/usr/share/doc/qt/qtwidgets/tutorials-addressbook.html
/usr/share/doc/qt/qtwidgets/widget-classes.html
/usr/share/doc/qt/qtwidgets/widgets-tutorial.html
/usr/share/doc/qt/qtwidgets/images/addressbook-adddialog.png
/usr/share/doc/qt/qtwidgets/images/addressbook-classes.png
/usr/share/doc/qt/qtwidgets/images/addressbook-editdialog.png
/usr/share/doc/qt/qtwidgets/images/addressbook-example.png
/usr/share/doc/qt/qtwidgets/images/addressbook-filemenu.png
/usr/share/doc/qt/qtwidgets/images/addressbook-newaddresstab.png
/usr/share/doc/qt/qtwidgets/images/addressbook-signals.png
/usr/share/doc/qt/qtwidgets/images/addressbook-toolsmenu.png
/usr/share/doc/qt/qtwidgets/images/addressbook-tutorial-part1-labeled-layout.png
/usr/share/doc/qt/qtwidgets/images/addressbook-tutorial-part1-labeled-screenshot.png
/usr/share/doc/qt/qtwidgets/images/addressbook-tutorial-part1-screenshot.png
/usr/share/doc/qt/qtwidgets/images/addressbook-tutorial-part2-add-contact.png
/usr/share/doc/qt/qtwidgets/images/addressbook-tutorial-part2-add-flowchart.png
/usr/share/doc/qt/qtwidgets/images/addressbook-tutorial-part2-add-successful.png
/usr/share/doc/qt/qtwidgets/images/addressbook-tutorial-part2-labeled-layout.png
/usr/share/doc/qt/qtwidgets/images/addressbook-tutorial-part2-signals-and-slots.png
/usr/share/doc/qt/qtwidgets/images/addressbook-tutorial-part2-stretch-effects.png
/usr/share/doc/qt/qtwidgets/images/addressbook-tutorial-part3-labeled-layout.png
/usr/share/doc/qt/qtwidgets/images/addressbook-tutorial-part3-linkedlist.png
/usr/share/doc/qt/qtwidgets/images/addressbook-tutorial-part3-screenshot.png
/usr/share/doc/qt/qtwidgets/images/addressbook-tutorial-part4-remove.png
/usr/share/doc/qt/qtwidgets/images/addressbook-tutorial-part5-finddialog.png
/usr/share/doc/qt/qtwidgets/images/addressbook-tutorial-part5-notfound.png
/usr/share/doc/qt/qtwidgets/images/addressbook-tutorial-part5-screenshot.png
/usr/share/doc/qt/qtwidgets/images/addressbook-tutorial-part5-signals-and-slots.png
/usr/share/doc/qt/qtwidgets/images/addressbook-tutorial-part6-load.png
/usr/share/doc/qt/qtwidgets/images/addressbook-tutorial-part6-save.png
/usr/share/doc/qt/qtwidgets/images/addressbook-tutorial-part6-screenshot.png
/usr/share/doc/qt/qtwidgets/images/addressbook-tutorial-part7-screenshot.png
/usr/share/doc/qt/qtwidgets/images/addressbook-tutorial-screenshot.png
/usr/share/doc/qt/qtwidgets/images/affine-demo.png
/usr/share/doc/qt/qtwidgets/images/analogclock-example.png
/usr/share/doc/qt/qtwidgets/images/analogclock-viewport.png
/usr/share/doc/qt/qtwidgets/images/animatedtiles-example.png
/usr/share/doc/qt/qtwidgets/images/application-menus.png
/usr/share/doc/qt/qtwidgets/images/application.png
/usr/share/doc/qt/qtwidgets/images/arrow_bc.png
/usr/share/doc/qt/qtwidgets/images/assistant-toolbar.png
/usr/share/doc/qt/qtwidgets/images/basicdrawing-example.png
/usr/share/doc/qt/qtwidgets/images/basicgraphicslayouts-example.png
/usr/share/doc/qt/qtwidgets/images/basiclayouts-example.png
/usr/share/doc/qt/qtwidgets/images/basicsortfiltermodel-example.png
/usr/share/doc/qt/qtwidgets/images/bgrContent.png
/usr/share/doc/qt/qtwidgets/images/blurpickereffect-example.png
/usr/share/doc/qt/qtwidgets/images/borderlayout-example.png
/usr/share/doc/qt/qtwidgets/images/boxes-demo.png
/usr/share/doc/qt/qtwidgets/images/branchindicatorimage.png
/usr/share/doc/qt/qtwidgets/images/btn_next.png
/usr/share/doc/qt/qtwidgets/images/btn_prev.png
/usr/share/doc/qt/qtwidgets/images/bullet_dn.png
/usr/share/doc/qt/qtwidgets/images/bullet_sq.png
/usr/share/doc/qt/qtwidgets/images/button.png
/usr/share/doc/qt/qtwidgets/images/buttonbox-gnomelayout-horizontal.png
/usr/share/doc/qt/qtwidgets/images/buttonbox-gnomelayout-vertical.png
/usr/share/doc/qt/qtwidgets/images/buttonbox-kdelayout-horizontal.png
/usr/share/doc/qt/qtwidgets/images/buttonbox-kdelayout-vertical.png
/usr/share/doc/qt/qtwidgets/images/buttonbox-mac-modeless-horizontal.png
/usr/share/doc/qt/qtwidgets/images/buttonbox-mac-modeless-vertical.png
/usr/share/doc/qt/qtwidgets/images/buttonbox-maclayout-horizontal.png
/usr/share/doc/qt/qtwidgets/images/buttonbox-maclayout-vertical.png
/usr/share/doc/qt/qtwidgets/images/buttonbox-winlayout-horizontal.png
/usr/share/doc/qt/qtwidgets/images/buttonbox-winlayout-vertical.png
/usr/share/doc/qt/qtwidgets/images/calculator-example.png
/usr/share/doc/qt/qtwidgets/images/calculator-ugly.png
/usr/share/doc/qt/qtwidgets/images/calendar-example.png
/usr/share/doc/qt/qtwidgets/images/calendarwidgetexample.png
/usr/share/doc/qt/qtwidgets/images/charactermap-example.png
/usr/share/doc/qt/qtwidgets/images/chart-example.png
/usr/share/doc/qt/qtwidgets/images/checkbox.png
/usr/share/doc/qt/qtwidgets/images/checkboxes-exclusive.png
/usr/share/doc/qt/qtwidgets/images/checkboxes-non-exclusive.png
/usr/share/doc/qt/qtwidgets/images/checkboxexample.png
/usr/share/doc/qt/qtwidgets/images/chip-demo.png
/usr/share/doc/qt/qtwidgets/images/classwizard-flow.png
/usr/share/doc/qt/qtwidgets/images/classwizard.png
/usr/share/doc/qt/qtwidgets/images/clock.png
/usr/share/doc/qt/qtwidgets/images/codecs-example.png
/usr/share/doc/qt/qtwidgets/images/codeeditor-example.png
/usr/share/doc/qt/qtwidgets/images/collidingmice-example.png
/usr/share/doc/qt/qtwidgets/images/coloreditorfactoryimage.png
/usr/share/doc/qt/qtwidgets/images/columnview.png
/usr/share/doc/qt/qtwidgets/images/combobox.png
/usr/share/doc/qt/qtwidgets/images/comboboximage.png
/usr/share/doc/qt/qtwidgets/images/combowidgetmapper-example.png
/usr/share/doc/qt/qtwidgets/images/completer-example-country.png
/usr/share/doc/qt/qtwidgets/images/completer-example-dirmodel.png
/usr/share/doc/qt/qtwidgets/images/completer-example-qdirmodel.png
/usr/share/doc/qt/qtwidgets/images/completer-example-word.png
/usr/share/doc/qt/qtwidgets/images/completer-example.png
/usr/share/doc/qt/qtwidgets/images/composition-demo.png
/usr/share/doc/qt/qtwidgets/images/concentriccircles-example.png
/usr/share/doc/qt/qtwidgets/images/conceptualpushbuttontree.png
/usr/share/doc/qt/qtwidgets/images/customcompleter-example.png
/usr/share/doc/qt/qtwidgets/images/customcompleter-insertcompletion.png
/usr/share/doc/qt/qtwidgets/images/customsortfiltermodel-example.png
/usr/share/doc/qt/qtwidgets/images/deform-demo.png
/usr/share/doc/qt/qtwidgets/images/designer-stylesheet-options.png
/usr/share/doc/qt/qtwidgets/images/designer-stylesheet-usage.png
/usr/share/doc/qt/qtwidgets/images/designer-validator-highlighter.png
/usr/share/doc/qt/qtwidgets/images/desktop-examples.png
/usr/share/doc/qt/qtwidgets/images/diagramscene.png
/usr/share/doc/qt/qtwidgets/images/dialog-examples.png
/usr/share/doc/qt/qtwidgets/images/digitalclock-example.png
/usr/share/doc/qt/qtwidgets/images/dirview-example.png
/usr/share/doc/qt/qtwidgets/images/dockwidget.png
/usr/share/doc/qt/qtwidgets/images/dockwidgetimage.png
/usr/share/doc/qt/qtwidgets/images/dockwidgets-example.png
/usr/share/doc/qt/qtwidgets/images/draganddroppuzzle-example.png
/usr/share/doc/qt/qtwidgets/images/dragdroprobot-example.png
/usr/share/doc/qt/qtwidgets/images/draggableicons-example.png
/usr/share/doc/qt/qtwidgets/images/draggabletext-example.png
/usr/share/doc/qt/qtwidgets/images/dropsite-example.png
/usr/share/doc/qt/qtwidgets/images/dummy_tree.png
/usr/share/doc/qt/qtwidgets/images/dynamiclayouts-example.png
/usr/share/doc/qt/qtwidgets/images/easing-example.png
/usr/share/doc/qt/qtwidgets/images/echopluginexample.png
/usr/share/doc/qt/qtwidgets/images/elasticnodes-example.png
/usr/share/doc/qt/qtwidgets/images/elidedlabel-example.png
/usr/share/doc/qt/qtwidgets/images/embeddeddialogs-demo.png
/usr/share/doc/qt/qtwidgets/images/example_model.png
/usr/share/doc/qt/qtwidgets/images/extension-example.png
/usr/share/doc/qt/qtwidgets/images/extension_more.png
/usr/share/doc/qt/qtwidgets/images/factorial-example.png
/usr/share/doc/qt/qtwidgets/images/fademessageeffect-example-faded.png
/usr/share/doc/qt/qtwidgets/images/fademessageeffect-example.png
/usr/share/doc/qt/qtwidgets/images/fetchmore-example.png
/usr/share/doc/qt/qtwidgets/images/filedialogurls.png
/usr/share/doc/qt/qtwidgets/images/findfiles-example.png
/usr/share/doc/qt/qtwidgets/images/findfiles_progress_dialog.png
/usr/share/doc/qt/qtwidgets/images/flowlayout-example.png
/usr/share/doc/qt/qtwidgets/images/fontsampler-example.png
/usr/share/doc/qt/qtwidgets/images/frames.png
/usr/share/doc/qt/qtwidgets/images/fridgemagnets-example.png
/usr/share/doc/qt/qtwidgets/images/frozencolumn-example.png
/usr/share/doc/qt/qtwidgets/images/frozencolumn-tableview.png
/usr/share/doc/qt/qtwidgets/images/fusion-calendarwidget.png
/usr/share/doc/qt/qtwidgets/images/fusion-colordialog.png
/usr/share/doc/qt/qtwidgets/images/fusion-combobox.png
/usr/share/doc/qt/qtwidgets/images/fusion-fontdialog.png
/usr/share/doc/qt/qtwidgets/images/fusion-label.png
/usr/share/doc/qt/qtwidgets/images/fusion-menu.png
/usr/share/doc/qt/qtwidgets/images/fusion-progressdialog.png
/usr/share/doc/qt/qtwidgets/images/fusion-pushbutton-menu.png
/usr/share/doc/qt/qtwidgets/images/fusion-statusbar-sizegrip.png
/usr/share/doc/qt/qtwidgets/images/fusion-style.png
/usr/share/doc/qt/qtwidgets/images/fusion-tabbar-truncated.png
/usr/share/doc/qt/qtwidgets/images/fusion-tabbar.png
/usr/share/doc/qt/qtwidgets/images/fusion-tabwidget.png
/usr/share/doc/qt/qtwidgets/images/geometry.png
/usr/share/doc/qt/qtwidgets/images/gradients-demo.png
/usr/share/doc/qt/qtwidgets/images/graphicsanchorlayout-example.png
/usr/share/doc/qt/qtwidgets/images/graphicseffect-blur.png
/usr/share/doc/qt/qtwidgets/images/graphicseffect-colorize.png
/usr/share/doc/qt/qtwidgets/images/graphicseffect-drop-shadow.png
/usr/share/doc/qt/qtwidgets/images/graphicseffect-opacity.png
/usr/share/doc/qt/qtwidgets/images/graphicseffect-plain.png
/usr/share/doc/qt/qtwidgets/images/graphicseffect-widget.png
/usr/share/doc/qt/qtwidgets/images/graphicsflowlayout-example.png
/usr/share/doc/qt/qtwidgets/images/graphicssimpleanchorlayout-example.png
/usr/share/doc/qt/qtwidgets/images/graphicsview-ellipseitem-pie.png
/usr/share/doc/qt/qtwidgets/images/graphicsview-ellipseitem.png
/usr/share/doc/qt/qtwidgets/images/graphicsview-examples.png
/usr/share/doc/qt/qtwidgets/images/graphicsview-items.png
/usr/share/doc/qt/qtwidgets/images/graphicsview-lineitem.png
/usr/share/doc/qt/qtwidgets/images/graphicsview-parentchild.png
/usr/share/doc/qt/qtwidgets/images/graphicsview-pathitem.png
/usr/share/doc/qt/qtwidgets/images/graphicsview-pixmapitem.png
/usr/share/doc/qt/qtwidgets/images/graphicsview-polygonitem.png
/usr/share/doc/qt/qtwidgets/images/graphicsview-rectitem.png
/usr/share/doc/qt/qtwidgets/images/graphicsview-simpletextitem.png
/usr/share/doc/qt/qtwidgets/images/graphicsview-textitem.png
/usr/share/doc/qt/qtwidgets/images/graphicsview-view.png
/usr/share/doc/qt/qtwidgets/images/graphicsview-zorder.png
/usr/share/doc/qt/qtwidgets/images/groupbox-example.png
/usr/share/doc/qt/qtwidgets/images/groupbox.png
/usr/share/doc/qt/qtwidgets/images/groupboximage.png
/usr/share/doc/qt/qtwidgets/images/header.png
/usr/share/doc/qt/qtwidgets/images/headerimage.png
/usr/share/doc/qt/qtwidgets/images/home.png
/usr/share/doc/qt/qtwidgets/images/i18n-example.png
/usr/share/doc/qt/qtwidgets/images/ico_note.png
/usr/share/doc/qt/qtwidgets/images/ico_note_attention.png
/usr/share/doc/qt/qtwidgets/images/ico_out.png
/usr/share/doc/qt/qtwidgets/images/icons-example.png
/usr/share/doc/qt/qtwidgets/images/icons-view-menu.png
/usr/share/doc/qt/qtwidgets/images/icons_find_normal.png
/usr/share/doc/qt/qtwidgets/images/icons_find_normal_disabled.png
/usr/share/doc/qt/qtwidgets/images/icons_images_groupbox.png
/usr/share/doc/qt/qtwidgets/images/icons_monkey.png
/usr/share/doc/qt/qtwidgets/images/icons_monkey_active.png
/usr/share/doc/qt/qtwidgets/images/icons_monkey_mess.png
/usr/share/doc/qt/qtwidgets/images/icons_preview_area.png
/usr/share/doc/qt/qtwidgets/images/icons_qt_extended_16x16.png
/usr/share/doc/qt/qtwidgets/images/icons_qt_extended_17x17.png
/usr/share/doc/qt/qtwidgets/images/icons_qt_extended_32x32.png
/usr/share/doc/qt/qtwidgets/images/icons_qt_extended_33x33.png
/usr/share/doc/qt/qtwidgets/images/icons_qt_extended_48x48.png
/usr/share/doc/qt/qtwidgets/images/icons_qt_extended_64x64.png
/usr/share/doc/qt/qtwidgets/images/icons_qt_extended_8x8.png
/usr/share/doc/qt/qtwidgets/images/icons_size_groupbox.png
/usr/share/doc/qt/qtwidgets/images/icons_size_spinbox.png
/usr/share/doc/qt/qtwidgets/images/imagecomposition-example.png
/usr/share/doc/qt/qtwidgets/images/imagegestures-example.jpg
/usr/share/doc/qt/qtwidgets/images/imageviewer-example.png
/usr/share/doc/qt/qtwidgets/images/imageviewer-fit_to_window_1.png
/usr/share/doc/qt/qtwidgets/images/imageviewer-fit_to_window_2.png
/usr/share/doc/qt/qtwidgets/images/imageviewer-original_size.png
/usr/share/doc/qt/qtwidgets/images/imageviewer-zoom_in_1.png
/usr/share/doc/qt/qtwidgets/images/imageviewer-zoom_in_2.png
/usr/share/doc/qt/qtwidgets/images/inputdialogs.png
/usr/share/doc/qt/qtwidgets/images/interview-demo.png
/usr/share/doc/qt/qtwidgets/images/itemviews-editabletreemodel-indexes.png
/usr/share/doc/qt/qtwidgets/images/itemviews-editabletreemodel-items.png
/usr/share/doc/qt/qtwidgets/images/itemviews-editabletreemodel-model.png
/usr/share/doc/qt/qtwidgets/images/itemviews-editabletreemodel-values.png
/usr/share/doc/qt/qtwidgets/images/itemviews-editabletreemodel.png
/usr/share/doc/qt/qtwidgets/images/itemviews-examples.png
/usr/share/doc/qt/qtwidgets/images/itemviewspuzzle-example.png
/usr/share/doc/qt/qtwidgets/images/layout1.png
/usr/share/doc/qt/qtwidgets/images/layout2.png
/usr/share/doc/qt/qtwidgets/images/licensewizard-example.png
/usr/share/doc/qt/qtwidgets/images/licensewizard-flow.png
/usr/share/doc/qt/qtwidgets/images/lineedits-example.png
/usr/share/doc/qt/qtwidgets/images/list_table_tree.png
/usr/share/doc/qt/qtwidgets/images/listview.png
/usr/share/doc/qt/qtwidgets/images/logo.png
/usr/share/doc/qt/qtwidgets/images/macos-lineedit.png
/usr/share/doc/qt/qtwidgets/images/macos-progressbar.png
/usr/share/doc/qt/qtwidgets/images/macos-style.png
/usr/share/doc/qt/qtwidgets/images/macos-style2.png
/usr/share/doc/qt/qtwidgets/images/macos-tabwidget.png
/usr/share/doc/qt/qtwidgets/images/mainwindow-demo.png
/usr/share/doc/qt/qtwidgets/images/mainwindow-docks-example.png
/usr/share/doc/qt/qtwidgets/images/mainwindow-docks.png
/usr/share/doc/qt/qtwidgets/images/mainwindow-examples.png
/usr/share/doc/qt/qtwidgets/images/mainwindowlayout.png
/usr/share/doc/qt/qtwidgets/images/mdi-cascade.png
/usr/share/doc/qt/qtwidgets/images/mdi-example.png
/usr/share/doc/qt/qtwidgets/images/mdi-tile.png
/usr/share/doc/qt/qtwidgets/images/menu.png
/usr/share/doc/qt/qtwidgets/images/menubar.png
/usr/share/doc/qt/qtwidgets/images/menubarimage.png
/usr/share/doc/qt/qtwidgets/images/menuimage.png
/usr/share/doc/qt/qtwidgets/images/menus-example.png
/usr/share/doc/qt/qtwidgets/images/modelview-combobox.png
/usr/share/doc/qt/qtwidgets/images/modelview-header.png
/usr/share/doc/qt/qtwidgets/images/modelview-models.png
/usr/share/doc/qt/qtwidgets/images/modelview-overview.png
/usr/share/doc/qt/qtwidgets/images/modelview-roles.png
/usr/share/doc/qt/qtwidgets/images/modelview-tablemodel.png
/usr/share/doc/qt/qtwidgets/images/modelview-treemodel.png
/usr/share/doc/qt/qtwidgets/images/modelview.png
/usr/share/doc/qt/qtwidgets/images/mousebutton-buttontester.png
/usr/share/doc/qt/qtwidgets/images/move-blocks-chart.png
/usr/share/doc/qt/qtwidgets/images/moveblocks-example.png
/usr/share/doc/qt/qtwidgets/images/movie-example.png
/usr/share/doc/qt/qtwidgets/images/msgbox1.png
/usr/share/doc/qt/qtwidgets/images/msgbox2.png
/usr/share/doc/qt/qtwidgets/images/msgbox3.png
/usr/share/doc/qt/qtwidgets/images/msgbox4.png
/usr/share/doc/qt/qtwidgets/images/notepad1.png
/usr/share/doc/qt/qtwidgets/images/notepad2.png
/usr/share/doc/qt/qtwidgets/images/notepad3.png
/usr/share/doc/qt/qtwidgets/images/notepad4.png
/usr/share/doc/qt/qtwidgets/images/orderform-example-detailsdialog.png
/usr/share/doc/qt/qtwidgets/images/orderform-example.png
/usr/share/doc/qt/qtwidgets/images/padnavigator-example.png
/usr/share/doc/qt/qtwidgets/images/painterpaths-example.png
/usr/share/doc/qt/qtwidgets/images/painting-examples.png
/usr/share/doc/qt/qtwidgets/images/paintsystem-icon.png
/usr/share/doc/qt/qtwidgets/images/paintsystem-stylepainter.png
/usr/share/doc/qt/qtwidgets/images/pangesture.png
/usr/share/doc/qt/qtwidgets/images/parent-child-widgets.png
/usr/share/doc/qt/qtwidgets/images/pathstroke-demo.png
/usr/share/doc/qt/qtwidgets/images/pinchgesture.png
/usr/share/doc/qt/qtwidgets/images/pingpong-example.png
/usr/share/doc/qt/qtwidgets/images/pixelator-example.png
/usr/share/doc/qt/qtwidgets/images/plugandpaint-plugindialog.png
/usr/share/doc/qt/qtwidgets/images/plugandpaint.png
/usr/share/doc/qt/qtwidgets/images/progressBar-stylesheet.png
/usr/share/doc/qt/qtwidgets/images/progressBar2-stylesheet.png
/usr/share/doc/qt/qtwidgets/images/progressbar.png
/usr/share/doc/qt/qtwidgets/images/progressbarimage.png
/usr/share/doc/qt/qtwidgets/images/propagation-custom.png
/usr/share/doc/qt/qtwidgets/images/propagation-standard.png
/usr/share/doc/qt/qtwidgets/images/pushbutton.png
/usr/share/doc/qt/qtwidgets/images/qactiongroup-align.png
/usr/share/doc/qt/qtwidgets/images/qcalendarwidget-grid.png
/usr/share/doc/qt/qtwidgets/images/qcalendarwidget-maximum.png
/usr/share/doc/qt/qtwidgets/images/qcalendarwidget-minimum.png
/usr/share/doc/qt/qtwidgets/images/qcolumnview.png
/usr/share/doc/qt/qtwidgets/images/qcompleter.png
/usr/share/doc/qt/qtwidgets/images/qdesktopwidget.png
/usr/share/doc/qt/qtwidgets/images/qerrormessage.png
/usr/share/doc/qt/qtwidgets/images/qformlayout-kde.png
/usr/share/doc/qt/qtwidgets/images/qformlayout-mac.png
/usr/share/doc/qt/qtwidgets/images/qformlayout-qpe.png
/usr/share/doc/qt/qtwidgets/images/qformlayout-win.png
/usr/share/doc/qt/qtwidgets/images/qformlayout-with-6-children.png
/usr/share/doc/qt/qtwidgets/images/qgraphicsproxywidget-embed.png
/usr/share/doc/qt/qtwidgets/images/qgridlayout-with-5-children.png
/usr/share/doc/qt/qtwidgets/images/qgridlayout.png
/usr/share/doc/qt/qtwidgets/images/qhboxlayout-with-5-children.png
/usr/share/doc/qt/qtwidgets/images/qmdisubwindowlayout.png
/usr/share/doc/qt/qtwidgets/images/qmessagebox-crit.png
/usr/share/doc/qt/qtwidgets/images/qmessagebox-info.png
/usr/share/doc/qt/qtwidgets/images/qmessagebox-quest.png
/usr/share/doc/qt/qtwidgets/images/qmessagebox-warn.png
/usr/share/doc/qt/qtwidgets/images/qscrollarea-noscrollbars.png
/usr/share/doc/qt/qtwidgets/images/qscrollarea-onescrollbar.png
/usr/share/doc/qt/qtwidgets/images/qscrollarea-twoscrollbars.png
/usr/share/doc/qt/qtwidgets/images/qscrollbar-picture.png
/usr/share/doc/qt/qtwidgets/images/qscrollbar-values.png
/usr/share/doc/qt/qtwidgets/images/qspinbox-plusminus.png
/usr/share/doc/qt/qtwidgets/images/qspinbox-updown.png
/usr/share/doc/qt/qtwidgets/images/qstyle-comboboxes.png
/usr/share/doc/qt/qtwidgets/images/qstyleoptiontoolbar-position.png
/usr/share/doc/qt/qtwidgets/images/qtableview-resized.png
/usr/share/doc/qt/qtwidgets/images/qtwizard-aero1.png
/usr/share/doc/qt/qtwidgets/images/qtwizard-aero2.png
/usr/share/doc/qt/qtwidgets/images/qtwizard-classic1.png
/usr/share/doc/qt/qtwidgets/images/qtwizard-classic2.png
/usr/share/doc/qt/qtwidgets/images/qtwizard-mac1.png
/usr/share/doc/qt/qtwidgets/images/qtwizard-mac2.png
/usr/share/doc/qt/qtwidgets/images/qtwizard-macpage.png
/usr/share/doc/qt/qtwidgets/images/qtwizard-modern1.png
/usr/share/doc/qt/qtwidgets/images/qtwizard-modern2.png
/usr/share/doc/qt/qtwidgets/images/qtwizard-nonmacpage.png
/usr/share/doc/qt/qtwidgets/images/qundoview.png
/usr/share/doc/qt/qtwidgets/images/qvboxlayout-with-5-children.png
/usr/share/doc/qt/qtwidgets/images/readonlytable_role.png
/usr/share/doc/qt/qtwidgets/images/regexp-example.png
/usr/share/doc/qt/qtwidgets/images/regularexpression-example.png
/usr/share/doc/qt/qtwidgets/images/richtext-examples.png
/usr/share/doc/qt/qtwidgets/images/rogue-example.png
/usr/share/doc/qt/qtwidgets/images/rogue-statechart.png
/usr/share/doc/qt/qtwidgets/images/rubberband.png
/usr/share/doc/qt/qtwidgets/images/rubberbandimage.png
/usr/share/doc/qt/qtwidgets/images/screenshot-example.png
/usr/share/doc/qt/qtwidgets/images/scribble-example.png
/usr/share/doc/qt/qtwidgets/images/scrollbar.png
/usr/share/doc/qt/qtwidgets/images/scrollbarimage.png
/usr/share/doc/qt/qtwidgets/images/sdi-example.png
/usr/share/doc/qt/qtwidgets/images/selected-items1.png
/usr/share/doc/qt/qtwidgets/images/selected-items2.png
/usr/share/doc/qt/qtwidgets/images/selected-items3.png
/usr/share/doc/qt/qtwidgets/images/selection-extended.png
/usr/share/doc/qt/qtwidgets/images/selection-multi.png
/usr/share/doc/qt/qtwidgets/images/selection-single.png
/usr/share/doc/qt/qtwidgets/images/selection2.png
/usr/share/doc/qt/qtwidgets/images/settingseditor-example.png
/usr/share/doc/qt/qtwidgets/images/shapedclock-dragging.png
/usr/share/doc/qt/qtwidgets/images/shapedclock-example.png
/usr/share/doc/qt/qtwidgets/images/shareddirmodel.png
/usr/share/doc/qt/qtwidgets/images/sharedmodel-tableviews.png
/usr/share/doc/qt/qtwidgets/images/sharedselection-tableviews.png
/usr/share/doc/qt/qtwidgets/images/signals-n-slots-aw-nat.png
/usr/share/doc/qt/qtwidgets/images/simpleanchorlayout-example.png
/usr/share/doc/qt/qtwidgets/images/simpledommodel-example.png
/usr/share/doc/qt/qtwidgets/images/simpletreemodel-example.png
/usr/share/doc/qt/qtwidgets/images/simplewidgetmapper-example.png
/usr/share/doc/qt/qtwidgets/images/sizegrip.png
/usr/share/doc/qt/qtwidgets/images/sizegripimage.png
/usr/share/doc/qt/qtwidgets/images/slider.png
/usr/share/doc/qt/qtwidgets/images/sliderimage.png
/usr/share/doc/qt/qtwidgets/images/sliders-example.png
/usr/share/doc/qt/qtwidgets/images/spinbox.png
/usr/share/doc/qt/qtwidgets/images/spinboxdelegate-example.png
/usr/share/doc/qt/qtwidgets/images/spinboxes-example.png
/usr/share/doc/qt/qtwidgets/images/spinboximage.png
/usr/share/doc/qt/qtwidgets/images/spreadsheet-demo.png
/usr/share/doc/qt/qtwidgets/images/standard-views.png
/usr/share/doc/qt/qtwidgets/images/standarddialogs-example.png
/usr/share/doc/qt/qtwidgets/images/standardwidget.png
/usr/share/doc/qt/qtwidgets/images/stardelegate.png
/usr/share/doc/qt/qtwidgets/images/states-example.png
/usr/share/doc/qt/qtwidgets/images/stickman-example.png
/usr/share/doc/qt/qtwidgets/images/stickman-example1.png
/usr/share/doc/qt/qtwidgets/images/stickman-example2.png
/usr/share/doc/qt/qtwidgets/images/stickman-example3.png
/usr/share/doc/qt/qtwidgets/images/stringlistmodel.png
/usr/share/doc/qt/qtwidgets/images/stylepluginexample.png
/usr/share/doc/qt/qtwidgets/images/styles-3d.png
/usr/share/doc/qt/qtwidgets/images/styles-aliasing.png
/usr/share/doc/qt/qtwidgets/images/styles-disabledwood.png
/usr/share/doc/qt/qtwidgets/images/styles-enabledwood.png
/usr/share/doc/qt/qtwidgets/images/styles-woodbuttons.png
/usr/share/doc/qt/qtwidgets/images/stylesheet-border-image-normal.png
/usr/share/doc/qt/qtwidgets/images/stylesheet-border-image-stretched.png
/usr/share/doc/qt/qtwidgets/images/stylesheet-border-image-wrong.png
/usr/share/doc/qt/qtwidgets/images/stylesheet-boxmodel.png
/usr/share/doc/qt/qtwidgets/images/stylesheet-branch-closed.png
/usr/share/doc/qt/qtwidgets/images/stylesheet-branch-end.png
/usr/share/doc/qt/qtwidgets/images/stylesheet-branch-more.png
/usr/share/doc/qt/qtwidgets/images/stylesheet-branch-open.png
/usr/share/doc/qt/qtwidgets/images/stylesheet-coffee-cleanlooks.png
/usr/share/doc/qt/qtwidgets/images/stylesheet-pagefold-mac.png
/usr/share/doc/qt/qtwidgets/images/stylesheet-pagefold.png
/usr/share/doc/qt/qtwidgets/images/stylesheet-redbutton1.png
/usr/share/doc/qt/qtwidgets/images/stylesheet-redbutton2.png
/usr/share/doc/qt/qtwidgets/images/stylesheet-redbutton3.png
/usr/share/doc/qt/qtwidgets/images/stylesheet-scrollbar1.png
/usr/share/doc/qt/qtwidgets/images/stylesheet-scrollbar2.png
/usr/share/doc/qt/qtwidgets/images/stylesheet-treeview.png
/usr/share/doc/qt/qtwidgets/images/stylesheet-vline.png
/usr/share/doc/qt/qtwidgets/images/sub-attaq-demo.png
/usr/share/doc/qt/qtwidgets/images/swipegesture.png
/usr/share/doc/qt/qtwidgets/images/syntaxhighlighter-example.png
/usr/share/doc/qt/qtwidgets/images/system-tray.png
/usr/share/doc/qt/qtwidgets/images/systemtray-editor.png
/usr/share/doc/qt/qtwidgets/images/systemtray-example.png
/usr/share/doc/qt/qtwidgets/images/tab.png
/usr/share/doc/qt/qtwidgets/images/tabWidget-stylesheet1.png
/usr/share/doc/qt/qtwidgets/images/tabWidget-stylesheet2.png
/usr/share/doc/qt/qtwidgets/images/tabWidget-stylesheet3.png
/usr/share/doc/qt/qtwidgets/images/tabdialog-example.png
/usr/share/doc/qt/qtwidgets/images/tableWidget-stylesheet.png
/usr/share/doc/qt/qtwidgets/images/tabletexample.png
/usr/share/doc/qt/qtwidgets/images/tableview.png
/usr/share/doc/qt/qtwidgets/images/tabwidget.png
/usr/share/doc/qt/qtwidgets/images/tetrix-example.png
/usr/share/doc/qt/qtwidgets/images/textedit-demo.png
/usr/share/doc/qt/qtwidgets/images/titlebar.png
/usr/share/doc/qt/qtwidgets/images/titlebarimage.png
/usr/share/doc/qt/qtwidgets/images/toolbar.png
/usr/share/doc/qt/qtwidgets/images/toolbarimage.png
/usr/share/doc/qt/qtwidgets/images/toolbox.png
/usr/share/doc/qt/qtwidgets/images/toolboximage.png
/usr/share/doc/qt/qtwidgets/images/toolbutton.png
/usr/share/doc/qt/qtwidgets/images/toolbuttonimage.png
/usr/share/doc/qt/qtwidgets/images/tooltips-example.png
/usr/share/doc/qt/qtwidgets/images/touch-dials-example.png
/usr/share/doc/qt/qtwidgets/images/touch-fingerpaint-example.png
/usr/share/doc/qt/qtwidgets/images/touch-knobs-example.png
/usr/share/doc/qt/qtwidgets/images/touch-pinchzoom-example.png
/usr/share/doc/qt/qtwidgets/images/trafficlight-example.png
/usr/share/doc/qt/qtwidgets/images/trafficlight-example1.png
/usr/share/doc/qt/qtwidgets/images/trafficlight-example2.png
/usr/share/doc/qt/qtwidgets/images/transformations-example.png
/usr/share/doc/qt/qtwidgets/images/transitions.png
/usr/share/doc/qt/qtwidgets/images/tree_2_with_algorithm.png
/usr/share/doc/qt/qtwidgets/images/treemodel-structure.png
/usr/share/doc/qt/qtwidgets/images/treemodelcompleter-example.png
/usr/share/doc/qt/qtwidgets/images/treeview.png
/usr/share/doc/qt/qtwidgets/images/trivialwizard-example-conclusion.png
/usr/share/doc/qt/qtwidgets/images/trivialwizard-example-flow.png
/usr/share/doc/qt/qtwidgets/images/trivialwizard-example-introduction.png
/usr/share/doc/qt/qtwidgets/images/trivialwizard-example-registration.png
/usr/share/doc/qt/qtwidgets/images/undodemo.png
/usr/share/doc/qt/qtwidgets/images/undoframeworkexample.png
/usr/share/doc/qt/qtwidgets/images/validators.png
/usr/share/doc/qt/qtwidgets/images/weatheranchorlayout-example.png
/usr/share/doc/qt/qtwidgets/images/whatsthis.png
/usr/share/doc/qt/qtwidgets/images/widget-examples.png
/usr/share/doc/qt/qtwidgets/images/widgetdelegate.png
/usr/share/doc/qt/qtwidgets/images/widgetmapper-combo-mapping.png
/usr/share/doc/qt/qtwidgets/images/widgetmapper-simple-mapping.png
/usr/share/doc/qt/qtwidgets/images/widgetmapper.png
/usr/share/doc/qt/qtwidgets/images/widgets-tutorial-childwidget.png
/usr/share/doc/qt/qtwidgets/images/widgets-tutorial-nestedlayouts.png
/usr/share/doc/qt/qtwidgets/images/widgets-tutorial-toplevel.png
/usr/share/doc/qt/qtwidgets/images/widgets-tutorial-windowlayout.png
/usr/share/doc/qt/qtwidgets/images/wiggly-example.png
/usr/share/doc/qt/qtwidgets/images/windowflags-example.png
/usr/share/doc/qt/qtwidgets/images/windowflags_controllerwindow.png
/usr/share/doc/qt/qtwidgets/images/windowflags_previewwindow.png
/usr/share/doc/qt/qtwidgets/images/windows-checkbox.png
/usr/share/doc/qt/qtwidgets/images/windows-combobox.png
/usr/share/doc/qt/qtwidgets/images/windows-dateedit.png
/usr/share/doc/qt/qtwidgets/images/windows-datetimeedit.png
/usr/share/doc/qt/qtwidgets/images/windows-dial.png
/usr/share/doc/qt/qtwidgets/images/windows-groupbox.png
/usr/share/doc/qt/qtwidgets/images/windows-label.png
/usr/share/doc/qt/qtwidgets/images/windows-lcdnumber.png
/usr/share/doc/qt/qtwidgets/images/windows-lineedit.png
/usr/share/doc/qt/qtwidgets/images/windows-listview.png
/usr/share/doc/qt/qtwidgets/images/windows-progressbar.png
/usr/share/doc/qt/qtwidgets/images/windows-pushbutton.png
/usr/share/doc/qt/qtwidgets/images/windows-radiobutton.png
/usr/share/doc/qt/qtwidgets/images/windows-slider.png
/usr/share/doc/qt/qtwidgets/images/windows-spinbox.png
/usr/share/doc/qt/qtwidgets/images/windows-style.png
/usr/share/doc/qt/qtwidgets/images/windows-style2.png
/usr/share/doc/qt/qtwidgets/images/windows-tableview.png
/usr/share/doc/qt/qtwidgets/images/windows-tabwidget.png
/usr/share/doc/qt/qtwidgets/images/windows-timeedit.png
/usr/share/doc/qt/qtwidgets/images/windows-treeview.png
/usr/share/doc/qt/qtwidgets/images/windows-vista-style.png
/usr/share/doc/qt/qtwidgets/images/windowstabimage.png
/usr/share/doc/qt/qtwidgets/images/windowsvista-fontcombobox.png
/usr/share/doc/qt/qtwidgets/images/windowsvista-pushbutton.png
/usr/share/doc/qt/qtwidgets/images/windowsvista-radiobutton.png
/usr/share/doc/qt/qtwidgets/images/windowsvista-tabwidget.png
/usr/share/doc/qt/qtwidgets/images/woodbackground.png
/usr/share/doc/qt/qtwidgets/images/woodbutton.png
/usr/share/doc/qt/qtwidgets/style/offline-simple.css
/usr/share/doc/qt/qtwidgets/style/offline.css
/usr/share/doc/qt/qtwinextras/examples-manifest.xml
/usr/share/doc/qt/qtwinextras/examples-qtwinextras.html
/usr/share/doc/qt/qtwinextras/qml-qtwinextras-dwmfeatures-members.html
/usr/share/doc/qt/qtwinextras/qml-qtwinextras-dwmfeatures.html
/usr/share/doc/qt/qtwinextras/qml-qtwinextras-jumplist-members.html
/usr/share/doc/qt/qtwinextras/qml-qtwinextras-jumplist.html
/usr/share/doc/qt/qtwinextras/qml-qtwinextras-jumplistcategory-members.html
/usr/share/doc/qt/qtwinextras/qml-qtwinextras-jumplistcategory.html
/usr/share/doc/qt/qtwinextras/qml-qtwinextras-jumplistdestination-members.html
/usr/share/doc/qt/qtwinextras/qml-qtwinextras-jumplistdestination.html
/usr/share/doc/qt/qtwinextras/qml-qtwinextras-jumplistlink-members.html
/usr/share/doc/qt/qtwinextras/qml-qtwinextras-jumplistlink.html
/usr/share/doc/qt/qtwinextras/qml-qtwinextras-jumplistseparator-members.html
/usr/share/doc/qt/qtwinextras/qml-qtwinextras-jumplistseparator.html
/usr/share/doc/qt/qtwinextras/qml-qtwinextras-taskbarbutton-members.html
/usr/share/doc/qt/qtwinextras/qml-qtwinextras-taskbarbutton.html
/usr/share/doc/qt/qtwinextras/qml-qtwinextras-thumbnailtoolbar-members.html
/usr/share/doc/qt/qtwinextras/qml-qtwinextras-thumbnailtoolbar.html
/usr/share/doc/qt/qtwinextras/qml-qtwinextras-thumbnailtoolbutton-members.html
/usr/share/doc/qt/qtwinextras/qml-qtwinextras-thumbnailtoolbutton.html
/usr/share/doc/qt/qtwinextras/qtwin.html
/usr/share/doc/qt/qtwinextras/qtwinextras-iconextractor-example.html
/usr/share/doc/qt/qtwinextras/qtwinextras-index.html
/usr/share/doc/qt/qtwinextras/qtwinextras-module.html
/usr/share/doc/qt/qtwinextras/qtwinextras-musicplayer-example.html
/usr/share/doc/qt/qtwinextras/qtwinextras-overview.html
/usr/share/doc/qt/qtwinextras/qtwinextras-qmlmodule.html
/usr/share/doc/qt/qtwinextras/qtwinextras-quickplayer-example.html
/usr/share/doc/qt/qtwinextras/qtwinextras.index
/usr/share/doc/qt/qtwinextras/qtwinextras.qhp
/usr/share/doc/qt/qtwinextras/qtwinextras.qhp.sha1
/usr/share/doc/qt/qtwinextras/qwinjumplist-members.html
/usr/share/doc/qt/qtwinextras/qwinjumplist.html
/usr/share/doc/qt/qtwinextras/qwinjumplistcategory-members.html
/usr/share/doc/qt/qtwinextras/qwinjumplistcategory.html
/usr/share/doc/qt/qtwinextras/qwinjumplistitem-members.html
/usr/share/doc/qt/qtwinextras/qwinjumplistitem.html
/usr/share/doc/qt/qtwinextras/qwinmime-members.html
/usr/share/doc/qt/qtwinextras/qwinmime.html
/usr/share/doc/qt/qtwinextras/qwintaskbarbutton-members.html
/usr/share/doc/qt/qtwinextras/qwintaskbarbutton.html
/usr/share/doc/qt/qtwinextras/qwintaskbarprogress-members.html
/usr/share/doc/qt/qtwinextras/qwintaskbarprogress.html
/usr/share/doc/qt/qtwinextras/qwinthumbnailtoolbar-members.html
/usr/share/doc/qt/qtwinextras/qwinthumbnailtoolbar.html
/usr/share/doc/qt/qtwinextras/qwinthumbnailtoolbutton-members.html
/usr/share/doc/qt/qtwinextras/qwinthumbnailtoolbutton.html
/usr/share/doc/qt/qtwinextras/images/arrow_bc.png
/usr/share/doc/qt/qtwinextras/images/bgrContent.png
/usr/share/doc/qt/qtwinextras/images/btn_next.png
/usr/share/doc/qt/qtwinextras/images/btn_prev.png
/usr/share/doc/qt/qtwinextras/images/bullet_dn.png
/usr/share/doc/qt/qtwinextras/images/bullet_sq.png
/usr/share/doc/qt/qtwinextras/images/glass.png
/usr/share/doc/qt/qtwinextras/images/home.png
/usr/share/doc/qt/qtwinextras/images/ico_note.png
/usr/share/doc/qt/qtwinextras/images/ico_note_attention.png
/usr/share/doc/qt/qtwinextras/images/ico_out.png
/usr/share/doc/qt/qtwinextras/images/jumplist.png
/usr/share/doc/qt/qtwinextras/images/logo.png
/usr/share/doc/qt/qtwinextras/images/peek-on.png
/usr/share/doc/qt/qtwinextras/images/qtwinextras-musicplayer-composited.png
/usr/share/doc/qt/qtwinextras/images/qtwinextras-musicplayer-non-composited.png
/usr/share/doc/qt/qtwinextras/images/qtwinextras-musicplayer-taskbar.png
/usr/share/doc/qt/qtwinextras/images/qtwinextras-musicplayer-thumbnail.png
/usr/share/doc/qt/qtwinextras/images/qtwinextras-quickplayer-composited.png
/usr/share/doc/qt/qtwinextras/images/qtwinextras-quickplayer-non-composited.png
/usr/share/doc/qt/qtwinextras/images/qtwinextras-quickplayer-taskbar.png
/usr/share/doc/qt/qtwinextras/images/qtwinextras-quickplayer-thumbnail.png
/usr/share/doc/qt/qtwinextras/images/taskbar-button.png
/usr/share/doc/qt/qtwinextras/images/taskbar-progress-indeterminate.png
/usr/share/doc/qt/qtwinextras/images/taskbar-progress-paused.png
/usr/share/doc/qt/qtwinextras/images/taskbar-progress-stopped.png
/usr/share/doc/qt/qtwinextras/images/taskbar-progress.png
/usr/share/doc/qt/qtwinextras/images/thumbbar.png
/usr/share/doc/qt/qtwinextras/style/offline-simple.css
/usr/share/doc/qt/qtwinextras/style/offline.css
/usr/share/doc/qt/qtx11extras/qtx11extras-index.html
/usr/share/doc/qt/qtx11extras/qtx11extras-module.html
/usr/share/doc/qt/qtx11extras/qtx11extras.index
/usr/share/doc/qt/qtx11extras/qtx11extras.qhp
/usr/share/doc/qt/qtx11extras/qtx11extras.qhp.sha1
/usr/share/doc/qt/qtx11extras/qx11info-members.html
/usr/share/doc/qt/qtx11extras/qx11info.html
/usr/share/doc/qt/qtx11extras/images/arrow_bc.png
/usr/share/doc/qt/qtx11extras/images/bgrContent.png
/usr/share/doc/qt/qtx11extras/images/btn_next.png
/usr/share/doc/qt/qtx11extras/images/btn_prev.png
/usr/share/doc/qt/qtx11extras/images/bullet_dn.png
/usr/share/doc/qt/qtx11extras/images/bullet_sq.png
/usr/share/doc/qt/qtx11extras/images/home.png
/usr/share/doc/qt/qtx11extras/images/ico_note.png
/usr/share/doc/qt/qtx11extras/images/ico_note_attention.png
/usr/share/doc/qt/qtx11extras/images/ico_out.png
/usr/share/doc/qt/qtx11extras/images/logo.png
/usr/share/doc/qt/qtx11extras/style/offline-simple.css
/usr/share/doc/qt/qtx11extras/style/offline.css
/usr/share/doc/qt/qtxml/examples-manifest.xml
/usr/share/doc/qt/qtxml/qdomattr-members.html
/usr/share/doc/qt/qtxml/qdomattr.html
/usr/share/doc/qt/qtxml/qdomcdatasection-members.html
/usr/share/doc/qt/qtxml/qdomcdatasection.html
/usr/share/doc/qt/qtxml/qdomcharacterdata-members.html
/usr/share/doc/qt/qtxml/qdomcharacterdata.html
/usr/share/doc/qt/qtxml/qdomcomment-members.html
/usr/share/doc/qt/qtxml/qdomcomment.html
/usr/share/doc/qt/qtxml/qdomdocument-members.html
/usr/share/doc/qt/qtxml/qdomdocument.html
/usr/share/doc/qt/qtxml/qdomdocumentfragment-members.html
/usr/share/doc/qt/qtxml/qdomdocumentfragment.html
/usr/share/doc/qt/qtxml/qdomdocumenttype-members.html
/usr/share/doc/qt/qtxml/qdomdocumenttype.html
/usr/share/doc/qt/qtxml/qdomelement-members.html
/usr/share/doc/qt/qtxml/qdomelement.html
/usr/share/doc/qt/qtxml/qdomentity-members.html
/usr/share/doc/qt/qtxml/qdomentity.html
/usr/share/doc/qt/qtxml/qdomentityreference-members.html
/usr/share/doc/qt/qtxml/qdomentityreference.html
/usr/share/doc/qt/qtxml/qdomimplementation-members.html
/usr/share/doc/qt/qtxml/qdomimplementation.html
/usr/share/doc/qt/qtxml/qdomnamednodemap-members.html
/usr/share/doc/qt/qtxml/qdomnamednodemap.html
/usr/share/doc/qt/qtxml/qdomnode-members.html
/usr/share/doc/qt/qtxml/qdomnode.html
/usr/share/doc/qt/qtxml/qdomnodelist-members.html
/usr/share/doc/qt/qtxml/qdomnodelist.html
/usr/share/doc/qt/qtxml/qdomnotation-members.html
/usr/share/doc/qt/qtxml/qdomnotation.html
/usr/share/doc/qt/qtxml/qdomprocessinginstruction-members.html
/usr/share/doc/qt/qtxml/qdomprocessinginstruction.html
/usr/share/doc/qt/qtxml/qdomtext-members.html
/usr/share/doc/qt/qtxml/qdomtext.html
/usr/share/doc/qt/qtxml/qtxml-dombookmarks-example.html
/usr/share/doc/qt/qtxml/qtxml-index.html
/usr/share/doc/qt/qtxml/qtxml-module.html
/usr/share/doc/qt/qtxml/qtxml-saxbookmarks-example.html
/usr/share/doc/qt/qtxml/qtxml-streambookmarks-example.html
/usr/share/doc/qt/qtxml/qtxml-xmlstreamlint-example.html
/usr/share/doc/qt/qtxml/qtxml.index
/usr/share/doc/qt/qtxml/qtxml.qhp
/usr/share/doc/qt/qtxml/qtxml.qhp.sha1
/usr/share/doc/qt/qtxml/qtxml.tags
/usr/share/doc/qt/qtxml/qxmlattributes-members.html
/usr/share/doc/qt/qtxml/qxmlattributes.html
/usr/share/doc/qt/qtxml/qxmlcontenthandler-members.html
/usr/share/doc/qt/qtxml/qxmlcontenthandler.html
/usr/share/doc/qt/qtxml/qxmldeclhandler-members.html
/usr/share/doc/qt/qtxml/qxmldeclhandler.html
/usr/share/doc/qt/qtxml/qxmldefaulthandler-members.html
/usr/share/doc/qt/qtxml/qxmldefaulthandler.html
/usr/share/doc/qt/qtxml/qxmldtdhandler-members.html
/usr/share/doc/qt/qtxml/qxmldtdhandler.html
/usr/share/doc/qt/qtxml/qxmlentityresolver-members.html
/usr/share/doc/qt/qtxml/qxmlentityresolver.html
/usr/share/doc/qt/qtxml/qxmlerrorhandler-members.html
/usr/share/doc/qt/qtxml/qxmlerrorhandler.html
/usr/share/doc/qt/qtxml/qxmlinputsource-members.html
/usr/share/doc/qt/qtxml/qxmlinputsource.html
/usr/share/doc/qt/qtxml/qxmllexicalhandler-members.html
/usr/share/doc/qt/qtxml/qxmllexicalhandler.html
/usr/share/doc/qt/qtxml/qxmllocator-members.html
/usr/share/doc/qt/qtxml/qxmllocator.html
/usr/share/doc/qt/qtxml/qxmlnamespacesupport-members.html
/usr/share/doc/qt/qtxml/qxmlnamespacesupport.html
/usr/share/doc/qt/qtxml/qxmlparseexception-members.html
/usr/share/doc/qt/qtxml/qxmlparseexception.html
/usr/share/doc/qt/qtxml/qxmlreader-members.html
/usr/share/doc/qt/qtxml/qxmlreader-obsolete.html
/usr/share/doc/qt/qtxml/qxmlreader.html
/usr/share/doc/qt/qtxml/qxmlsimplereader-members.html
/usr/share/doc/qt/qtxml/qxmlsimplereader.html
/usr/share/doc/qt/qtxml/xml-dom-tml.html
/usr/share/doc/qt/qtxml/xml-namespaces.html
/usr/share/doc/qt/qtxml/xml-processing.html
/usr/share/doc/qt/qtxml/xml-sax.html
/usr/share/doc/qt/qtxml/xml-streaming.html
/usr/share/doc/qt/qtxml/xml-tools.html
/usr/share/doc/qt/qtxml/images/arrow_bc.png
/usr/share/doc/qt/qtxml/images/bgrContent.png
/usr/share/doc/qt/qtxml/images/btn_next.png
/usr/share/doc/qt/qtxml/images/btn_prev.png
/usr/share/doc/qt/qtxml/images/bullet_dn.png
/usr/share/doc/qt/qtxml/images/bullet_sq.png
/usr/share/doc/qt/qtxml/images/dombookmarks-example.png
/usr/share/doc/qt/qtxml/images/home.png
/usr/share/doc/qt/qtxml/images/ico_note.png
/usr/share/doc/qt/qtxml/images/ico_note_attention.png
/usr/share/doc/qt/qtxml/images/ico_out.png
/usr/share/doc/qt/qtxml/images/logo.png
/usr/share/doc/qt/qtxml/images/saxbookmarks-example.png
/usr/share/doc/qt/qtxml/images/xmlstreamexample-filemenu.png
/usr/share/doc/qt/qtxml/images/xmlstreamexample-helpmenu.png
/usr/share/doc/qt/qtxml/images/xmlstreamexample-screenshot.png
/usr/share/doc/qt/qtxml/style/offline-simple.css
/usr/share/doc/qt/qtxml/style/offline.css
/usr/share/doc/qt/qtxmlpatterns/examples-manifest.xml
/usr/share/doc/qt/qtxmlpatterns/qabstractmessagehandler-members.html
/usr/share/doc/qt/qtxmlpatterns/qabstractmessagehandler.html
/usr/share/doc/qt/qtxmlpatterns/qabstracturiresolver-members.html
/usr/share/doc/qt/qtxmlpatterns/qabstracturiresolver.html
/usr/share/doc/qt/qtxmlpatterns/qabstractxmlnodemodel-members.html
/usr/share/doc/qt/qtxmlpatterns/qabstractxmlnodemodel.html
/usr/share/doc/qt/qtxmlpatterns/qabstractxmlreceiver-members.html
/usr/share/doc/qt/qtxmlpatterns/qabstractxmlreceiver.html
/usr/share/doc/qt/qtxmlpatterns/qhash-proxy.html
/usr/share/doc/qt/qtxmlpatterns/qml-qtquick-xmllistmodel-xmllistmodel-members.html
/usr/share/doc/qt/qtxmlpatterns/qml-qtquick-xmllistmodel-xmllistmodel.html
/usr/share/doc/qt/qtxmlpatterns/qml-qtquick-xmllistmodel-xmlrole-members.html
/usr/share/doc/qt/qtxmlpatterns/qml-qtquick-xmllistmodel-xmlrole.html
/usr/share/doc/qt/qtxmlpatterns/qsimplexmlnodemodel-members.html
/usr/share/doc/qt/qtxmlpatterns/qsimplexmlnodemodel.html
/usr/share/doc/qt/qtxmlpatterns/qsourcelocation-members.html
/usr/share/doc/qt/qtxmlpatterns/qsourcelocation.html
/usr/share/doc/qt/qtxmlpatterns/qtquick-xmllistmodel-qmlmodule.html
/usr/share/doc/qt/qtxmlpatterns/qtxmlpatterns-attribution-xml-xsd.html
/usr/share/doc/qt/qtxmlpatterns/qtxmlpatterns-filetree-example.html
/usr/share/doc/qt/qtxmlpatterns/qtxmlpatterns-index.html
/usr/share/doc/qt/qtxmlpatterns/qtxmlpatterns-module.html
/usr/share/doc/qt/qtxmlpatterns/qtxmlpatterns-recipes-example.html
/usr/share/doc/qt/qtxmlpatterns/qtxmlpatterns-schema-example.html
/usr/share/doc/qt/qtxmlpatterns/qtxmlpatterns-xquery-example.html
/usr/share/doc/qt/qtxmlpatterns/qtxmlpatterns.index
/usr/share/doc/qt/qtxmlpatterns/qtxmlpatterns.qhp
/usr/share/doc/qt/qtxmlpatterns/qtxmlpatterns.qhp.sha1
/usr/share/doc/qt/qtxmlpatterns/qtxmlpatterns.tags
/usr/share/doc/qt/qtxmlpatterns/qxmlformatter-members.html
/usr/share/doc/qt/qtxmlpatterns/qxmlformatter.html
/usr/share/doc/qt/qtxmlpatterns/qxmlitem-members.html
/usr/share/doc/qt/qtxmlpatterns/qxmlitem.html
/usr/share/doc/qt/qtxmlpatterns/qxmlname-members.html
/usr/share/doc/qt/qtxmlpatterns/qxmlname.html
/usr/share/doc/qt/qtxmlpatterns/qxmlnamepool-members.html
/usr/share/doc/qt/qtxmlpatterns/qxmlnamepool.html
/usr/share/doc/qt/qtxmlpatterns/qxmlnodemodelindex-members.html
/usr/share/doc/qt/qtxmlpatterns/qxmlnodemodelindex.html
/usr/share/doc/qt/qtxmlpatterns/qxmlquery-members.html
/usr/share/doc/qt/qtxmlpatterns/qxmlquery.html
/usr/share/doc/qt/qtxmlpatterns/qxmlresultitems-members.html
/usr/share/doc/qt/qtxmlpatterns/qxmlresultitems.html
/usr/share/doc/qt/qtxmlpatterns/qxmlschema-members.html
/usr/share/doc/qt/qtxmlpatterns/qxmlschema.html
/usr/share/doc/qt/qtxmlpatterns/qxmlschemavalidator-members.html
/usr/share/doc/qt/qtxmlpatterns/qxmlschemavalidator.html
/usr/share/doc/qt/qtxmlpatterns/qxmlserializer-members.html
/usr/share/doc/qt/qtxmlpatterns/qxmlserializer.html
/usr/share/doc/qt/qtxmlpatterns/xmlpattern-examples.html
/usr/share/doc/qt/qtxmlpatterns/xmlprocessing.html
/usr/share/doc/qt/qtxmlpatterns/xquery-introduction.html
/usr/share/doc/qt/qtxmlpatterns/images/arrow_bc.png
/usr/share/doc/qt/qtxmlpatterns/images/bgrContent.png
/usr/share/doc/qt/qtxmlpatterns/images/btn_next.png
/usr/share/doc/qt/qtxmlpatterns/images/btn_prev.png
/usr/share/doc/qt/qtxmlpatterns/images/bullet_dn.png
/usr/share/doc/qt/qtxmlpatterns/images/bullet_sq.png
/usr/share/doc/qt/qtxmlpatterns/images/filetree_1-example.png
/usr/share/doc/qt/qtxmlpatterns/images/filetree_2-example.png
/usr/share/doc/qt/qtxmlpatterns/images/home.png
/usr/share/doc/qt/qtxmlpatterns/images/ico_note.png
/usr/share/doc/qt/qtxmlpatterns/images/ico_note_attention.png
/usr/share/doc/qt/qtxmlpatterns/images/ico_out.png
/usr/share/doc/qt/qtxmlpatterns/images/logo.png
/usr/share/doc/qt/qtxmlpatterns/images/patternist-wordProcessor.png
/usr/share/doc/qt/qtxmlpatterns/images/recipes-example.png
/usr/share/doc/qt/qtxmlpatterns/images/schema-example.png
/usr/share/doc/qt/qtxmlpatterns/style/offline-simple.css
/usr/share/doc/qt/qtxmlpatterns/style/offline.css
/usr/share/licenses/qt5-doc

See Also

Package Description
qt5-examples-5.13.1-1-any.pkg.tar.xz Examples and demos from qt5 documentation
qt5-gamepad-5.13.1-1-x86_64.pkg.tar.xz Adds support for getting events from gamepad devices
qt5-graphicaleffects-5.13.1-1-x86_64.pkg.tar.xz Graphical effects for use with Qt Quick 2
qt5-imageformats-5.13.1-1-x86_64.pkg.tar.xz Plugins for additional image formats: TIFF, MNG, TGA, WBMP
qt5-location-5.13.1-1-x86_64.pkg.tar.xz Provides access to position, satellite and area monitoring classes
qt5-lottie-5.13.1-1-x86_64.pkg.tar.xz A family of player software for a certain json-based file format for describing 2d vector graphics animations
qt5-multimedia-5.13.1-1-x86_64.pkg.tar.xz Classes for audio, video, radio and camera functionality
qt5-networkauth-5.13.1-1-x86_64.pkg.tar.xz Network authentication module
qt5-purchasing-5.13.1-1-x86_64.pkg.tar.xz Qt In-App Purchasing API
qt5-quickcontrols-5.13.1-1-x86_64.pkg.tar.xz Reusable Qt Quick based UI controls to create classic desktop-style user interfaces
qt5-quickcontrols2-5.13.1-1-x86_64.pkg.tar.xz Next generation user interface controls based on Qt Quick
qt5-remoteobjects-5.13.1-1-x86_64.pkg.tar.xz Inter-process communication (IPC) module developed for Qt
qt5-script-5.13.1-1-x86_64.pkg.tar.xz Classes for making Qt applications scriptable. Provided for Qt 4.x compatibility
qt5-scxml-5.13.1-1-x86_64.pkg.tar.xz Static and runtime integration of SCXML models into Qt code
qt5-sensors-5.13.1-1-x86_64.pkg.tar.xz Provides access to sensor hardware and motion gesture recognition
Advertisement
Advertisement